(data stored in SCRATCH zone)

EMBL: CP001875.YHAJ

CP001875.YHAJ        Location/Qualifiers
FT   CDS_pept        415823..416692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaJ"
FT                   /locus_tag="PANA_0345"
FT                   /product="YhaJ"
FT                   /note="Putative HTH-type transcriptional regulator YhaJ;
FT                   Similar to Enterobacter cancerogenus ATCC 35316,
FT                   transcriptional regulator, LysR family protein (NCBI:
FT                   ZP_05969837.1); COG: Transcription; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75512"
FT                   /db_xref="GOA:D4GHY2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHY2"
FT                   /protein_id="ADD75512.1"
FT                   /translation="MHKTTLEQWSLLDKVVREGSFARAASLTNRSQSSVSYNLAMLQQR
FT                   IGITLLHAEGRKAVLTPAGELLLAQVRPLLKAFHSLEAFAGSIRSGVRTKLDLVVDSIF
FT                   PRRQLFSVLKAFQQCHPHTQINLTEVLETNTDYAEADVMVVTQRQDMAGRGEWLMNVDF
FT                   VAVAHCDHPLHQHGGILDEERLAQYPLIRIADREHFTVQDESSNGDYWSFSTIEAAVEA
FT                   VVHQVGYGWIPFERIEHELAQGTLKILPLQHGVRRATPLHLLIKKDILTLDPQIVTLLD
FT                   LLKNATRS"
     atgcataaaa ccacactgga gcagtggagc ctgttggaca aggtggtgcg agagggcagt        60
     tttgccagag cggcgagtct gaccaaccgc agtcagtcat ccgtcagcta taaccttgct       120
     atgttgcagc agcgcatagg gattacgctg ttacatgcag agggacgcaa ggcggtgctg       180
     acgcccgcag gcgagttgct gctggcgcag gtgcgcccgc tactgaaagc ttttcattca       240
     ctggaggcgt ttgcgggatc aatacgcagc ggcgtcagaa caaagctgga tctggtggtt       300
     gacagcatct ttccgcgtcg acaactgttt tccgtcctta aggcgtttca gcaatgccat       360
     cctcatactc agatcaacct gaccgaggtg ctggaaacca acaccgatta cgccgaggcc       420
     gacgtgatgg tggtgaccca gcgccaggat atggccgggc ggggagagtg gttgatgaat       480
     gtggatttcg tcgccgtggc gcactgcgac catcccttgc atcagcatgg cggcatcctg       540
     gatgaagaac ggttggcaca gtatccgctg attcgcattg ccgaccggga acatttcacc       600
     gtgcaggatg agagcagcaa tggcgattac tggtcgtttt cgactattga ggcggcggta       660
     gaggcggtgg tgcaccaggt gggttatggc tggatcccct tcgagcgcat cgaacatgaa       720
     ctggcgcagg gaacactaaa aatattgccc ttacagcacg gcgttcgtcg tgccaccccg       780
     ctgcacttac tgattaagaa agatatcctg acgctggatc cacaaattgt taccctgctc       840
     gatctgctga aaaacgccac ccgttcgtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page