(data stored in SCRATCH zone)

EMBL: CP001875.YHBC

CP001875.YHBC        Location/Qualifiers
FT   CDS_pept        525248..525712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbC"
FT                   /locus_tag="PANA_0455"
FT                   /product="YhbC"
FT                   /note="Hypothetical UPF0090 protein YhbC; Similar to
FT                   Erwinia tasmaniensis Et1/99, YhbC-like protein (NCBI:
FT                   YP_001906299.1); COG: Unknown Function; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75622"
FT                   /db_xref="GOA:D4GI92"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI92"
FT                   /protein_id="ADD75622.1"
FT                   /translation="MGVGLSTLEQKLTELVSAPVEALGYELVGIEFVRGRTSTLRIYID
FT                   SEDGINVDDCADVSHQVSAVMDVEDPITVPYHLEVSSPGLDRPLFTAEHYARFTGDEVS
FT                   LVLRMAVQNRRKWQGIIKSVEGEMITVNVEGNDEVFALSNIQKANLVPHF"
     ttgggggtgg gcttgtccac attagagcaa aaattgacag agttggtatc tgctccggta        60
     gaagcgctcg gctacgaact ggtcggaatt gaattcgttc gtggtcgcac atcaaccctg       120
     cgcatctata ttgatagtga agatggcatc aatgttgacg attgcgcgga cgtcagccac       180
     caggtgagtg cggtgatgga tgtggaagat cccatcacgg taccttacca ccttgaagtg       240
     tcctcaccgg ggctcgatcg tcctctgttc actgcagaac attatgcacg ctttaccggc       300
     gatgaggtga gcctggtgct gcgtatggcc gttcaaaacc gccgtaaatg gcagggaatc       360
     atcaagtctg ttgagggcga gatgataacg gtaaacgttg agggtaacga cgaggtgttc       420
     gcgctgagta atattcagaa agcgaacctg gtcccccact tttaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page