(data stored in SCRATCH zone)

EMBL: CP001875.YHJG

CP001875.YHJG        Location/Qualifiers
FT   CDS_pept        160127..162208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjG"
FT                   /locus_tag="PANA_0140"
FT                   /product="YhjG"
FT                   /note="AsmA Family Protein; Similar to Pantoea sp. At-9b,
FT                   AsmA family protein (NCBI: ZP_05730654.1); COG: Cell
FT                   wall/membrane/envelope biogenesis; Subcellular localization
FT                   as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75307"
FT                   /db_xref="GOA:D4GGK6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGK6"
FT                   /protein_id="ADD75307.1"
FT                   /translation="MKEQGGSLMSRAGKIVSWIGGIVVLLIVVVVIVIATFDWNRLKPT
FT                   INQKVSAELNRPFAIRGDLGVAWQRNPEEPGWRGWLPWPHLHAEDIMLGNPPDIPDVTM
FT                   IHLQRVDATLAPLALLHKEVFIPWIKLQQPDARLIQTADKKNNWTFTLADSDSKDDNAP
FT                   PSAWSFRLDNILFDQGTILYRDAVNQADVTLKVNPLGKPVPYSQIAGGDDKQQGAGDFV
FT                   FGWQASGSYHNEKLTGQGKIGGMLSLRSQTTAFPIQADVRNGSTRVQLTGGVQDPLNLG
FT                   GLDVRLRFSGDTLANLYGLTGVLLPDTPPYETDGRLIAKFTGKDGAVFRYQGFNGHIGD
FT                   SDIHGSLTYSQGKPRPKLVGELRSDQLRMADLGPLIGVNSGKGSEKTEQAKAKRGEKTV
FT                   QPADRVLPHDRFDTKSWDVMDADVKFSGKRIEHSSSLPLSDLYTHLQLDNGNLLLDPLR
FT                   FGMAGGNLNSTIRLEGNRSPMRGRADIHARKLRLRQLFPDVQAMQNSLGQLNGDASLTG
FT                   TGNSVADLLATSNGQLKLLMNDGLISRNLMEIAGLNVGNYLVGKLFGDDEVRINCAATD
FT                   LKLQNGLATPNLFVFDTENAVINVSGNANFANERLDLSVNPESKGIRIVTLRSPLYVRG
FT                   TFKHPDAGVKTGPLLARGAAAVALGAVVGPAAALLALISPSDTDENQCSRVLQQMKKK"
     gtgaaagagc agggaggaag cctaatgtca cgcgccggaa aaattgtaag ctggattggc        60
     gggattgttg tattgctgat cgtcgttgta gtgatagtca ttgcaacatt cgactggaat       120
     cgcctgaaac ccactattaa tcagaaagtg tctgcggaac ttaaccgtcc ctttgccatt       180
     cggggggatt tgggcgtcgc atggcagcgt aaccctgaag aacccggatg gcgcggctgg       240
     ttaccctggc ctcatctgca cgccgaagac attatgttgg gcaatccccc tgatattcct       300
     gacgtgacca tgatccacct gcaacgcgtg gacgccacac ttgcccctct ggccctactg       360
     cacaaagaag tttttattcc gtggataaaa ctgcagcagc cggatgcccg cctgattcag       420
     accgccgata agaaaaacaa ctggaccttc accctcgctg acagcgacag caaagatgac       480
     aatgcgccac cttcagcctg gtcatttcgt ctcgataata ttctgttcga tcagggcacc       540
     attctctacc gcgatgccgt taaccaggcc gatgtcacgc tgaaggttaa cccgctcggc       600
     aagcctgtgc cctattcaca aatcgcgggc ggagacgata aacaacaagg cgcgggtgat       660
     tttgtctttg gctggcaggc aagcggcagc taccacaatg aaaaactcac ggggcagggc       720
     aagattggcg gcatgttatc cctgcgtagt cagaccacag cgttcccgat tcaggcagac       780
     gttcggaacg gtagcacgcg cgtacagctg accggcggcg ttcaggatcc cctgaatctg       840
     ggcgggctgg acgtgcgtct acgtttttct ggcgatacgt tggcaaacct ctatggtctg       900
     accggcgttc tgttaccgga taccccgcct tatgaaactg atggccgcct gattgccaaa       960
     tttaccggca aagacggtgc cgtttttcgt taccagggat ttaatggtca tattggcgac      1020
     agcgatattc atggctctct gacctacagc cagggcaagc cacggccaaa actggtcggt      1080
     gaactcagat cggatcagtt acgtatggcg gatctgggcc cgttgatcgg cgttaactcg      1140
     ggcaagggca gcgagaaaac cgaacaggcc aaggcaaaac gcggtgaaaa aaccgtacag      1200
     cctgcggatc gcgttctgcc tcacgacagg ttcgacacca aaagctggga cgttatggat      1260
     gcggatgtga agtttagcgg caagcgcatc gaacacagca gttcactacc gttgagcgat      1320
     ctttataccc atttgcagct cgataacgga aacctgctgc ttgatccact gcgtttcggt      1380
     atggcgggcg gtaatctgaa cagcaccatc cgcctggaag ggaatcgctc accgatgcgg      1440
     ggccgggccg atattcatgc ccgtaaactt cgcctgcgcc agctgttccc cgacgtacag      1500
     gcaatgcaaa acagccttgg gcagctgaac ggcgatgcca gcctgaccgg caccggcaac      1560
     tccgttgctg acctgctggc aaccagcaac ggtcagttga aactgctgat gaacgacgga      1620
     ctgatcagcc gcaacctgat ggaaattgcc ggactcaacg tcggcaacta tctggtcggt      1680
     aagctgtttg gtgatgatga agttcgtatt aactgtgcgg ccaccgatct taaactgcaa      1740
     aacggtctgg ccacgccaaa cctgttcgtg ttcgatacgg aaaatgccgt cattaacgtg      1800
     tcaggcaacg cgaactttgc caacgagcgg ctggatcttt cagtcaatcc agaaagtaaa      1860
     ggcatccgaa tcgtgaccct gcgctcgccc ttgtatgttc ggggcacctt caagcatccg      1920
     gacgctggcg tgaaaaccgg tcccttactg gcacgcgggg cggcggcggt ggcattaggt      1980
     gctgtggtcg ggcctgcggc agcgctgttg gcgctgattt cacccagtga tactgacgag      2040
     aatcagtgca gccgggtcct gcagcaaatg aagaagaagt ga                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page