(data stored in SCRATCH zone)

EMBL: CP001875.YHJJ

CP001875.YHJJ        Location/Qualifiers
FT   CDS_pept        154796..156304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjJ"
FT                   /locus_tag="PANA_0135"
FT                   /product="YhjJ"
FT                   /note="Protein YhjJ precursor; Similar to Pantoea sp.
FT                   At-9b, peptidase M16 domain protein (NCBI: ZP_05730650.1);
FT                   COG: General function prediction only; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75302"
FT                   /db_xref="GOA:D4GGK1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGK1"
FT                   /protein_id="ADD75302.1"
FT                   /translation="MQGTRIRLLVGGLVLAATSYGAPAETLQPDPAWQQGRLDNGFNWQ
FT                   LLATPQRPSDRIELRMVVNTGSLVESAQQTGFSHLLSRLALVHNTALDTNQQRALWQQS
FT                   IDPQRPLPPVISSYDYTQYNLSLPNNRPELLKEALNWLAATAGDMAITNQVVDTALSAS
FT                   DPVRTWPADTQDVWWRYRLKGSALLAHDPAEKPRAPVDVAQLKSFYQQWYTPDAMTLYV
FT                   VGNVDSRNLSEQINKAFSPLEGKRSAPASMPTLSPLPHDPVNLVSGTLAQDRLSLVWDT
FT                   PWQPIRDSQNLQRYWRSDLAREALFWHVQRAMSNKKVQGVQVGFDCRVLYQRAQCSINM
FT                   DTRNDSLEQNMNLVARELAAVRDNGLPQEEFDALMAQKLLELNKLFTTYARTDTDVLIS
FT                   QRLRSQRNSVVDIAPEQYQKLRQDFLSGLTRDQLNQELRQQLSQELMMVLIQPEGESET
FT                   NVKSLKTGWDKLMTLPATASAPAAGGDVSQPDSNAAGDAAPPTS"
     atgcagggca ccagaattcg gcttttggtt ggtggattag tactggcagc gaccagttac        60
     ggtgcgccgg cagaaacgct gcaacctgat ccagcctggc aacagggaag actggacaac       120
     ggatttaact ggcaactgtt ggcaacaccg caacggccaa gcgatcgcat tgagttacgc       180
     atggtggtta ataccggttc actggtggaa agcgcccagc aaaccggttt tagccacctt       240
     ttgtcacgcc tggcgctggt acacaatacc gccctggata cgaatcagca gcgcgcatta       300
     tggcagcaga gtatcgatcc acagcggcct ctgccgccgg ttatttcatc gtatgattac       360
     acgcaataca atttaagcct gcccaataac cgccctgagt tactgaaaga agccctgaac       420
     tggctggcgg ccacggcggg tgatatggcg attaccaatc aggttgtcga tacagccctg       480
     tccgcttccg atccggtaag aacctggcct gcggatactc aggatgtctg gtggcgctat       540
     cggctgaaag gatcggcgtt gctagcgcac gatccggctg agaagccgcg tgcccccgtt       600
     gacgtcgcgc agctgaaaag tttctaccag cagtggtata caccagatgc catgacactt       660
     tatgtcgtcg gcaatgtcga cagccgtaac ctttccgaac aaatcaacaa agcgttttca       720
     ccgctggaag gcaagcgcag cgcccctgca tccatgccca ccctgtctcc tttaccgcac       780
     gatccggtta atctggtcag cggcacgtta gcgcaggatc gcctgtccct tgtctgggat       840
     acgccgtggc agcccatccg ggactcacag aacttgcagc gttactggcg tagcgatctg       900
     gcgcgcgaag cgctgttctg gcacgtgcag cgcgcgatga gcaataaaaa agttcagggt       960
     gtgcaggtgg gatttgactg tcgggtgctt taccagcgcg cgcagtgttc cattaatatg      1020
     gatacgcgca atgacagcct ggaacagaat atgaacctgg ttgcccgcga gctggctgcc      1080
     gtgcgcgata acggtttgcc acaggaagag tttgatgccc tgatggccca aaaacttctg      1140
     gagctgaata agctgttcac aacctacgcg cgcacagata ctgacgtgct gattagccag      1200
     cgtttacgat cgcagcgcaa ttcagtggta gatattgccc cggagcagta tcaaaagctg      1260
     cggcaggatt ttctctccgg cctgacgcgc gatcagctca atcaggagtt gcggcagcaa      1320
     cttagtcagg agttaatgat ggtactgatt caaccggaag gtgaatcaga aaccaacgtt      1380
     aagagcctta aaacgggctg ggataagctg atgacgttgc ctgcgacagc atctgcacca      1440
     gcggccggcg gggacgtcag ccagccggac agtaacgctg ccggtgatgc agcgccaccg      1500
     acctcctga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page