(data stored in SCRATCH zone)

EMBL: CP001875.YIGM

CP001875.YIGM        Location/Qualifiers
FT   CDS_pept        209732..210592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yigM"
FT                   /locus_tag="PANA_0183"
FT                   /product="YigM"
FT                   /note="Carboxylate/Amino Acid/Amine Transporter; Similar to
FT                   Pantoea sp. At-9b, carboxylate/amino acid/amine transporter
FT                   (NCBI: ZP_05730693.1); COG: Carbohydrate transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75350"
FT                   /db_xref="GOA:D4GGP9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGP9"
FT                   /protein_id="ADD75350.1"
FT                   /translation="MLLLIVTTILWAFSFSLIGEYLAGQVDSWFSVLMRLALAAIVFLP
FT                   FLRWRGYRPSTLLLYMLVGMLQLGIMYLLSFEAYLYLSVSEFLLFTVMTPLYVTLIYDL
FT                   ISRRPLRVGYIFSALLAVAGAAIIRYDKVSDNFWFGLLLVQLANICFAAGMVGYKRLQE
FT                   TRPMPQHTAFSWFYLGAVLIAIVAWAAWGNPHKLPTTTLQWGILVWLGVAASGLGYFMW
FT                   NYGATQVDAGTLGIMNNMHVPAGLLVNLAIWQQKPHWPSFIAGAIVIMASLWVHKRWVV
FT                   GNSAR"
     gtgcttttat tgattgttac taccattctg tgggcattct cctttagcct gatcggtgaa        60
     taccttgccg ggcaagtgga cagctggttt tcagtgctga tgcgcctggc gctggccgcc       120
     attgtgtttc tgccgttcct gcgctggcgc ggctatcggc cttcgacgct cttgctctat       180
     atgctggtag ggatgttgca gctgggcatt atgtatttgc tgagttttga agcctatctg       240
     tatctgagcg tgtcagaatt cctgctgttc accgtaatga cgccgctgta tgtcacctta       300
     atctacgacc tgataagtcg aaggcccctg cgcgtgggct acattttcag tgcgctgctg       360
     gccgttgctg gcgcggcaat cattcgttat gacaaagtca gcgataactt ctggtttggt       420
     ctgctgctgg tccagttggc gaatatctgc ttcgcggcgg ggatggtggg ctacaaacgt       480
     ttgcaggaaa cccgtccaat gccgcaacat acggcgtttt catggtttta tctgggcgcg       540
     gttctgattg cgatcgttgc ctgggcagcc tggggcaatc cccataaatt gcctaccacg       600
     acgctgcaat ggggcattct ggtctggctg ggcgtcgcgg cttcggggct gggctacttt       660
     atgtggaact acggcgcgac gcaggtcgat gctggcacgt tgggcattat gaataacatg       720
     cacgttccgg ccggcttatt ggtgaacctg gcgatatggc agcagaagcc gcactggcca       780
     agctttatcg caggagccat cgtgattatg gcgtcgctgt gggtccataa gcgatgggtg       840
     gtaggcaaca gcgcaagata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page