(data stored in SCRATCH zone)

EMBL: CP001875.YJCB

CP001875.YJCB        Location/Qualifiers
FT   CDS_pept        complement(340479..340703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcB"
FT                   /locus_tag="PANA_0280"
FT                   /product="YjcB"
FT                   /note="Hypothetical Protein YjcB; Similar to Pantoea sp.
FT                   At-9b, putative inner membrane protein (NCBI:
FT                   ZP_05731747.1); COG: Unknown Function; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75447"
FT                   /db_xref="GOA:D4GHD2"
FT                   /db_xref="InterPro:IPR016958"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHD2"
FT                   /protein_id="ADD75447.1"
FT                   /translation="MMFFASTLKTRLRQDSHHVMAFLCGSVGVGMSCWFVTGLMGITLS
FT                   MENVHHFFSVSKDVFIDVMSRAPANWQMP"
     atgatgtttt ttgccagcac gctaaaaacc cgtctccgcc aggacagtca tcacgtcatg        60
     gcgtttctct gtggcagcgt aggcgttggg atgtcgtgct ggttcgtgac cggcttgatg       120
     ggcatcacgt tgagtatgga aaacgtgcac catttcttta gcgtctctaa agatgtcttt       180
     atcgacgtga tgagtcgagc gcccgctaac tggcaaatgc cctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page