(data stored in SCRATCH zone)

EMBL: CP001887.ADK

CP001887.ADK         Location/Qualifiers
FT   CDS_pept        complement(143424..144161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="G9768_00660"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG0563 Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17818"
FT                   /protein_id="ADH17818.1"
FT                   /translation="MDRSPLFLIIMGAPGSGKGTQSKLLASQLSLLHISSGDLLRDAVS
FT                   KDTPLSQEIKSYLDQGKLLPDTLVWKLVHEKLDEFQQDTLLRRLSFLSRSENSAILDGF
FT                   PRTVTQAKLLHEFLSSYFPNYKVILLDISDEEVLNRLTSRYICPACQGIYNEQQGFSSC
FT                   PKCSVELIRRSDDTLEVILDRIQTYKQETQPVLDYYTEKQKLITIDANAPTQQVFQRIL
FT                   DSLSASLVYQERDCCNCDCDDED"
     atggatcgat cccctctttt tcttattatt atgggcgccc caggatccgg gaaaggcacc        60
     cagtcaaagt tactagcatc tcaattatcc ctcctgcata ttagttctgg agacttgctt       120
     agagatgcgg tttccaaaga taccccgctc agccaagaaa ttaagtctta tctagaccag       180
     gggaagttgc ttccagatac attggtttgg aagttagtgc acgaaaaact agatgaattc       240
     caacaggata cgttattacg acgactttct ttcctatctc gttctgagaa cagtgctatt       300
     ttagatggct tcccaagaac tgtcacccaa gcgaagcttt tacatgagtt tcttagttcc       360
     tacttcccca attacaaagt tattctgtta gacatttctg atgaagaagt tcttaatcgg       420
     ttgacttctc ggtatatttg tccagcttgt caaggcatct acaatgaaca acaaggattt       480
     tcttcctgcc ctaaatgctc tgtagaactt attcgccgat cagatgacac tctagaagtg       540
     atcctagata gaattcaaac gtacaaacag gaaactcaac ctgttctgga ttattataca       600
     gagaagcaaa agctcatcac tattgatgct aatgctccca ctcaacaagt attccagcgt       660
     atcctagata gcctttctgc ttctcttgtc tatcaagaaa gagactgttg caactgcgat       720
     tgcgatgatg aagactag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page