(data stored in SCRATCH zone)

EMBL: CP001887.FABZ

CP001887.FABZ        Location/Qualifiers
FT   CDS_pept        complement(599895..600356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="G9768_02790"
FT                   /product="(3R)-hydroxymyristoyl-ACP dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18239"
FT                   /protein_id="ADH18239.1"
FT                   /translation="MNEKPVLGIQDIQNLLPHRYPFLLVDKILSYDLNTRSVVAQKNVT
FT                   INEPFFAGHFPGAPIMPGVLILEALAQAAGVLLGIILENDRDKKIALFLGIQKAKFRQP
FT                   VKPGDVLTLKAEFSLISAKGGKAFAQAFVGSQVVAEGELSFVLVKKESI"
     atgaatgaaa agcccgtgtt aggtatacag gacatacaaa atttacttcc ccatcggtat        60
     ccctttttat tggtggataa aattctttct tacgatttaa acactcgttc ggtagtggct       120
     cagaaaaatg taacaattaa cgaacctttt tttgcgggac attttcctgg agctcctatc       180
     atgcccggag ttttaatact ggaagctttg gctcaagctg ctggagtgtt gttagggatt       240
     atattggaaa acgatcgaga taaaaagatc gctttgttct taggtatcca gaaagcaaaa       300
     ttccgtcagc ctgttaaacc tggagacgta ttaaccttga aagccgagtt ctctttaatc       360
     tcggctaaag gtgggaaggc ttttgcacaa gcctttgtag gttctcaggt agtcgctgaa       420
     ggagagctca gctttgttct tgttaaaaaa gagtccatat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page