(data stored in SCRATCH zone)

EMBL: CP001887.GYRB

CP001887.GYRB        Location/Qualifiers
FT   CDS_pept        complement(213431..215845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="G9768_00980"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17879"
FT                   /protein_id="ADH17879.1"
FT                   /translation="MDAQEKKYDASAITVLEGLQAVRERPGMYIGDTGVTGLHHLVYEV
FT                   VDNSIDEAMAGFCTEVVVRILEDGGISISDNGRGIPIQIHEKESAKQGREISALEVVLT
FT                   VLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKFIAKVFKDGQAYSMEFSRGAPLTTLQ
FT                   VLGPTDKRGTEVLFYPDPAIFSTCVFDRAILMKRLRELAFLNRGVTIVFEDDRDTGFDK
FT                   VVFFYEGGIQSFVSYLNQNKEILFPNPIYMQGSRPGDDGDIEFEAALQWNSGYSELIYS
FT                   YANNIPTRQGGTHLTGFSTALTRAVNSYIKAHNLSKSDKLSLTGEDIKEGLVAIVSVKV
FT                   PNPQFEGQTKQKLGNSDVGSVSQQISGEVLTTFFEENPQIAKTIVDKVFVAAQAREAAK
FT                   RARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAILP
FT                   IRGKILNVEKARLQKVFQNQEIGSIIAALGCGIGKDNFNLSKLRYKRIIIMTDADVDGS
FT                   HIRTLLLTFFYRHMSALIENECVYIAQPPLYRVSKKKDFRYILSEKEMDGYLLNLGTKE
FT                   SQIVFDDTLRDLRGEALETFVNLILEVESFIVSLEKKAIPFSEFLDMFRDGAYPLYYYP
FT                   PESGKQGGSYLYSHEEKEAAIAANEESASRILELYKGSVLEELQRDLGDYGYDIRNYLH
FT                   PKGSGITVSTEDPKISPYVCYTLKEVIDYLKGLGRKGIEIQRYKGLGEMNADQLWDTTM
FT                   NPEQRTLVRVSLKDAVEADHIFTMLMGEEVPPRREFIESHALSIRMNNLDI"
     atggacgcac aagaaaagaa atacgacgca tcagccatca ccgttttaga aggattgcaa        60
     gctgttcgtg agcgtcctgg aatgtacatt ggtgatacag gagttaccgg attgcatcac       120
     ttggtttatg aagtggtgga taacagtatc gatgaggcaa tggcgggttt ttgtaccgag       180
     gtcgttgttc gcatattgga agacggaggt atttctattt cggataacgg tcgaggaatt       240
     cctattcaga ttcacgaaaa agaatctgcc aagcaaggac gcgaaatttc cgctttagag       300
     gtggttctta ccgtactaca tgcgggaggt aaatttgata aagacagtta taaggtttct       360
     ggaggcttgc atggagtagg agtttcgtgc gttaacgctc tgtccgaaaa attcattgca       420
     aaagtattta aagatggaca agcgtatagc atggagtttt caagaggcgc tccgttaacg       480
     actttacagg tgcttggtcc tacagacaaa cgaggtacag aagttctctt ttatccagat       540
     ccagctatat tctctacgtg cgtctttgat cgcgcgattt taatgaagcg tttgcgagaa       600
     ttagcatttt taaatcgtgg agtcacgatt gtttttgaag atgaccgtga tacgggattt       660
     gataaagtcg ttttcttcta tgaaggcgga attcaatcat tcgtcagtta cctcaaccaa       720
     aataaagaaa ttcttttccc aaatcctatt tatatgcagg gatcgagacc tggagatgat       780
     ggggatatag aatttgaggc cgctttacag tggaattctg gttactccga attaatctat       840
     tcttacgcta ataatattcc tacaagacaa ggcggaactc atttaacagg attttctacg       900
     gctcttactc gggcagtaaa ctcctatatt aaagctcata atctatctaa aagtgacaag       960
     ttgtctttga ctggagaaga catcaaagag gggctagtag caattgtttc cgttaaagtg      1020
     cccaatcctc agtttgaagg gcaaacaaaa caaaaacttg gaaatagtga tgtcggatcg      1080
     gtttctcagc aaattagtgg tgaggtgtta accacatttt ttgaagaaaa tcctcaaatt      1140
     gctaaaacga ttgtagacaa ggtgttcgtt gcagcccaag ctagagaagc tgctaagaga      1200
     gctagagagc taactcttcg gaaaagtgct ttagatagcg ctcgcttacc aggtaagtta      1260
     attgactgct tggaaaaaga tcctgaaaaa tgtgaaatgt atattgtgga aggagactct      1320
     gcgggaggtt cagctaagca gggacgagat cgtcgttttc aagcaattct tcctattcgt      1380
     ggtaagatcc tgaatgttga gaaagctcgt ttacaaaaag ttttccaaaa ccaggaaatt      1440
     ggaagcatta tagcagcttt aggatgtgga attgggaagg ataatttcaa cctcagcaaa      1500
     ttgcgttata aacgtattat tattatgaca gatgctgacg tggacggttc tcatattcga      1560
     accttgttgc taacattctt ctatagacat atgtccgctt tgatagaaaa tgaatgcgtc      1620
     tatattgcgc aacctccttt atatcgagtg agcaagaaaa aagatttccg ttacattctc      1680
     tcagaaaaag agatggatgg ctatttgctg aacttaggaa caaaagaaag ccagatagtt      1740
     tttgatgaca ccttaaggga tctgagaggg gaagctttag aaacgttcgt taatcttatt      1800
     ctagaggtcg aaagttttat tgtttcttta gagaaaaaag cgattccatt ttctgaattc      1860
     ttggatatgt tccgagacgg agcttatcct ttgtattact atcctccaga aagtgggaag      1920
     cagggaggca gttatctcta ttctcatgaa gagaaggaag cagctattgc tgccaatgaa      1980
     gaatctgctt cgcggatttt agaattatat aaaggttctg ttctcgaaga acttcagcgc      2040
     gatttaggtg attacggtta cgatatccgg aattacctcc atccaaaagg atctggtatt      2100
     acagtttcta cagaagatcc gaaaatatct ccgtatgttt gttacacctt gaaagaggta      2160
     atagactact taaaaggcct tggaagaaaa ggaattgaga ttcaacggta taaaggtctt      2220
     ggagagatga atgcagatca gttgtgggat acaacaatga atcctgagca aaggactctc      2280
     gttagagtct ctttaaagga tgcggtcgaa gcagaccata tctttacaat gttaatggga      2340
     gaagaggtac ctccaagacg tgagttcatt gagagtcacg ctttatccat tcggatgaat      2400
     aatttagata tttag                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page