(data stored in SCRATCH zone)

EMBL: CP001887.LPXB

CP001887.LPXB        Location/Qualifiers
FT   CDS_pept        469958..471781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="G9768_02120"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="COG3952 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18106"
FT                   /protein_id="ADH18106.1"
FT                   /translation="MFPQKITLWLYPLGLFANLFFGTAFCVQWSLTRKKGYSVVPKIFW
FT                   YLSGTGAVFMICHGFIQSQYPIALLHSFNLIIYFRNLNIASLNPLPVSKIASLLVSVAT
FT                   AITVSFAIGTRYLPHMTWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWFYLE
FT                   YKNQSALPAPFWKASLLGGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRK
FT                   PFSNSCFISAGEHSGDTLGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQV
FT                   SGFWEVLLALPKLWYRYQLLYRNILKTNPRTVICIDFPDFHFLLIKKLRSRGYKGKIVH
FT                   YVCPSIWAWRPSRKTVLEKYLDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPN
FT                   LNWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYD
FT                   HLILEVLQQNRCLHSHIVPSQFRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRP
FT                   LDTFLAKYIFNIILPAYSLPNIILGRTIFPEFIGGKKDFQYEDVAAALNILKTSQAQEK
FT                   QKDSCRDVYQAINESASSMKECLSLIFETAS"
     atgtttcccc aaaaaattac actctggtta taccctctag gactattcgc caacctcttc        60
     tttggcacag ctttttgtgt tcaatggtct ttaactagaa agaaagggta ttctgtcgtt       120
     cccaagattt tttggtatct gtccggtacc ggcgccgttt tcatgatttg ccatggattt       180
     attcaaagtc agtatcctat tgctttgttg cattcgttta atctgattat ttatttccgg       240
     aacctgaata tcgcctctct aaatcccctt cctgtttcga aaatagcttc tctactagtc       300
     tcagtagcaa cagcgatcac ggtatctttt gctattggaa cgcgttacct ccctcatatg       360
     acgtggatgg catccccaaa tatcctccat ttgaatctac cagaagcgag tttgtcatgg       420
     cagctgatag gatgtatcgg attgacgatc ttctcattga gatttttcat ccagtggttc       480
     tatctcgaat acaaaaacca atccgccctg cccgctcctt tttggaaagc aagcctacta       540
     ggaggatcta tctgccttct ctatttccta agaacggggg acctcgtaaa cgtgttatgt       600
     tatggatgcg ggttattccc ttctttagca aatctacgta tcgcttcacg agaagctttc       660
     cgcaaacctt ttagcaatag ctgctttatt tctgcgggcg aacatagtgg agatactttg       720
     ggagggaatt tattaaaaga aatgcacgca aaataccctg atattcattg ctttggcgtg       780
     gggggaccgc aaatgcgtgc acagaatttt catgcacttt tcgctatgga gaaatttcag       840
     gttagcggat tctgggaagt acttttagca ctacctaaat tatggtaccg ctatcagctt       900
     ctctatagaa atattctgaa aacaaatccg cgcacagtga tttgcattga tttccctgat       960
     tttcatttct tattaataaa aaaattacgc tctcgaggat ataaaggaaa gattgttcac      1020
     tatgtatgcc ctagcatatg ggcttggaga ccttcacgga aaacagtttt ggaaaaatat      1080
     ctagacctgc ttttactaat acttcctttt gaacaaaact tattcaaaga ttcagctctg      1140
     cgtacagtct atttagggca tcctctttct gaaacaatta aaagcttttc tcccaatcta      1200
     aattggaaag atcagctcca tcttcctacc gataaacctt tcattgcagc gtttcctggt      1260
     agccgtcgca gcgatatcct gcgtaatcta accattcaag tgcaggcctt tcaagcatcc      1320
     tctcttgcat ccacacacca tttacttgta tcgtctgcaa atccggaata tgaccatctt      1380
     atcctcgaag tgcttcaaca gaatcggtgt ttgcacagtc atattgttcc ttcccagttt      1440
     cgttatgaat taatgagaga atgtgatttt gccctcgcca aatgtggaac tatcgtccta      1500
     gaaacggctc tcaatctaac tcctacgatc gtcacttgcc agctccgacc tttggatact      1560
     tttttagcta agtatatctt taatattatc cttccagcct actcgctccc taatatcatt      1620
     ctaggcagaa cgatttttcc tgaattcata ggtgggaaaa aagattttca atatgaagat      1680
     gttgctgctg ctctaaacat tctgaaaaca tctcaagctc aagaaaaaca aaaagactct      1740
     tgcagagatg tgtatcaagc aatcaatgaa tctgcatcct ctatgaaaga gtgtctttct      1800
     ctcatattcg aaacagcttc ctaa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page