(data stored in SCRATCH zone)

EMBL: CP001887.PE10

CP001887.PE10        Location/Qualifiers
FT   CDS_pept        9373..9804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00050"
FT                   /product="hypothetical protein"
FT                   /note="COG1426 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17698"
FT                   /protein_id="ADH17698.1"
FT                   /translation="MSEHVHKELLHLGEVFRSQREERALSLKDVEAATSIRLSALEAIE
FT                   AGHLGKLISPVYAQGFMKKYAAFLDMDGDRLLKEHPYVLKIFQEFSDQNMDMLLDLESM
FT                   GGRNSPEKAIRSWLNLGWAGVFVVGAACIWWLGNLFNLF"
     atgagcgaac atgtccacaa agagttatta catctagggg aagtttttcg ttcgcaaaga        60
     gaagaaagag cgctttctct aaaagatgta gaagctgcca catctattcg tttgtctgca       120
     ttagaggcta tagaagcagg acatctcggg aaattaattt ctcctgttta tgcccaaggt       180
     tttatgaaaa aatacgcagc ttttttggat atggatgggg atagattgct gaaagagcat       240
     ccttatgtat tgaaaatttt tcaggaattt tctgatcaga atatggacat gctgcttgat       300
     ttagaatcca tgggaggaag aaattctcct gagaaagcga tccgtagttg gttaaatcta       360
     ggctgggctg gagtcttcgt cgtaggtgca gcttgtattt ggtggctagg gaatctattc       420
     aaccttttct ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page