(data stored in SCRATCH zone)

EMBL: CP001887.PE115

CP001887.PE115       Location/Qualifiers
FT   CDS_pept        130686..133289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00585"
FT                   /product="chaperone-protease ClpB"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17803"
FT                   /protein_id="ADH17803.1"
FT                   /translation="MEKFSDAVSEALEKAFELAKNSKHSYVTENHLLKSLLQNPGSLFC
FT                   LVIKDVHGNLGLLTSAVDDALRREPTVVEGTAVASPSPSLQQLLLNAHQEARSMGDEYL
FT                   SGDHLLLAFWRSTKEPFASWRKTVKTTSEALKELITKLRQGSRMDSPSAEENLKGLEKY
FT                   CKNLTVLAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLALRI
FT                   VQGDVPESLKEKHLYVLDMGALIAGAKYRGEFEERLKSVLKGVEASEGECILFIDEVHT
FT                   LVGAGATDGAMDAANLLKPALARGTLHCIGATTLNEYQKYIEKDAALERRFQPIFVTEP
FT                   SLEDAVFILRGLREKYEIFHGVRITEGALNAAVVLSYRYITDRFLPDKAIDLIDEAASL
FT                   IRMQIGSLPLPIDEKERELSALIVKQEAIKREQAPAYQEEAEDMQKAIDRVKEELAALR
FT                   LRWDEEKGLIAGLKEKKNALENLKFAEEEAERTADYNRVAELRYSLIPSLEEEIHLAEE
FT                   ALNQRDGRLLQEEVDERLIAQVVANWTGIPVQKMLEGESEKLLVLEESLEERVVGQPFA
FT                   IAAVSDSIRAARVGLSDPQRPLGVFLFLGPTGVGKTELAKALAELLFNKEEAMIRFDMT
FT                   EYMEKHSVSKLIGSPPGYVGYEEGGSLSEALRRRPYSVVLFDEIEKADKEVFNILLQIF
FT                   DDGILTDSKKRKVNCKNALFIMTSNIGSQELADYCTKKGTIVDKEAVLSVVAPVLKNYF
FT                   SPEFINRIDDILPFVPLTTEDIVKIVGIQMNRVALRLLERKISLTWDDSLVLFLSEQGY
FT                   DSAFGARPLKRLIQQKVVTMLSKALLKGDIKPGMAVELTMAKDVVVFKIKTNPAV"
     atggagaaat tttcagatgc agtaagcgaa gccttagaaa aggcgtttga gttagctaaa        60
     aactctaagc attcctacgt gacagaaaac catttgctga aaagtctttt gcaaaatcca       120
     ggctccctat tttgtttggt cattaaggat gtgcacggta atcttggttt gcttacttct       180
     gctgtggacg acgccttacg cagagaacca actgtagtcg agggaaccgc tgttgctagt       240
     ccttctccaa gtttacagca gttgttgctc aatgcgcatc aagaagctag aagtatgggt       300
     gacgaatatc tatcagggga tcatttgtta ctagcttttt ggcgatcgac taaagagcct       360
     tttgcttctt ggagaaaaac tgtaaaaact acctctgaag cgttgaaaga attaattact       420
     aaattaagac aaggaagtcg tatggactca cctagtgctg aagaaaatct gaaaggatta       480
     gagaaatact gcaaaaattt gactgtactt gcaagagaag gcaagcttga tcctgtgatt       540
     ggtcgagatg aagagattag acgtacgata caggttcttt ctagacgaac aaagaataat       600
     cctatgttga taggggagcc cggagttggg aaaacagcaa tcgctgaagg acttgctctt       660
     cgcatagtgc aaggggatgt tccagagagt ttaaaggaaa agcatctgta tgtactggat       720
     atgggagctt tgattgcagg tgccaagtat cgaggagagt ttgaagagcg gttaaaaagt       780
     gtattgaagg gtgtagaagc ttctgaaggc gagtgtatcc tattcattga tgaagtgcat       840
     actttagtag gagcgggagc tacagatgga gctatggatg cagcgaatct attaaagcct       900
     gctttagcac gaggcacttt gcattgtatt ggcgctacga ctttgaatga ataccaaaaa       960
     tatatagaga aagacgcggc tttggaacgg cgtttccagc ctatttttgt aacagaacct      1020
     tctttggaag atgctgtatt cattctccgg gggttaaggg aaaaatatga aatttttcat      1080
     ggtgtgcgca ttacagaagg ggctttgaat gcagctgtag ttctttctta tcgttacatc      1140
     acagaccgat ttcttcctga taaggcgatt gacctaattg atgaggctgc gagtttaatc      1200
     cgtatgcaaa taggaagttt acctctgcct attgatgaaa aggaaagaga attatcagct      1260
     ttaatcgtga aacaagaagc tattaaacgc gagcaagcac cagcttatca ggaagaggct      1320
     gaagacatgc aaaaagcaat tgaccgggtt aaggaagagc tggccgcttt acgcttgcgc      1380
     tgggatgaag aaaaaggatt aattgcagga ttaaaagaaa agaagaatgc tttagaaaat      1440
     ttaaaatttg ccgaagagga agctgagcgt actgccgatt acaatcgggt agcagaacta      1500
     cgctatagtt tgattccttc tttggaggaa gaaattcatt tagctgagga agctttaaat      1560
     caaagagatg ggcgcctgct tcaagaggaa gttgatgagc ggttgattgc gcaagttgtt      1620
     gcgaattgga ctggaatccc tgtgcaaaaa atgttggagg gagaatctga aaagttattg      1680
     gtgttggagg aatctttaga agaaagggtt gtcggacaac ctttcgctat tgccgcagtc      1740
     agtgattcga ttcgagctgc tcgagtagga ttgagtgatc cgcagcgtcc tctaggagtg      1800
     tttctatttc ttggacctac aggagtaggg aaaactgagc ttgctaaagc attagcagag      1860
     cttttattta ataaggaaga agcgatgatt cggtttgaca tgaccgaata tatggaaaaa      1920
     cattccgttt ccaaattgat aggatctcct ccagggtatg taggatatga agaaggaggg      1980
     agtctctcag aagctttaag aagacgacct tattctgttg ttctttttga tgagatagaa      2040
     aaagcagata aagaagtatt taatatttta ttgcagattt ttgatgatgg gattcttacg      2100
     gatagcaaga agcgtaaggt aaattgtaag aatgctcttt tcattatgac atcaaatatt      2160
     ggttcgcaag agcttgctga ttattgtact aagaaaggaa ctatcgtaga caaagaagct      2220
     gtgctatctg ttgttgcccc tgtgcttaaa aattatttta gtccagaatt tatcaatcgt      2280
     atcgatgaca ttctgccttt cgttcctttg actacggaag acattgtaaa aattgtcggt      2340
     attcaaatga atcgggttgc tttacgtttg ctggaaagaa aaatttcgtt aacttgggat      2400
     gattctttag tgctatttct cagtgagcaa ggttatgaca gcgcttttgg agctcgccct      2460
     ctgaagcgtt tgatacagca aaaagtagtg actatgttgt ctaaagctct tttgaaagga      2520
     gatatcaaac ctggaatggc ggtggagctt actatggcaa aagatgtagt tgtgtttaaa      2580
     attaaaacaa atccagctgt gtag                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page