(data stored in SCRATCH zone)

EMBL: CP001887.PE118

CP001887.PE118       Location/Qualifiers
FT   CDS_pept        135513..135911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00600"
FT                   /product="inclusion membrane protein E"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17806"
FT                   /protein_id="ADH17806.1"
FT                   /translation="MECVKQLCRNHLCLDNLTGPVRSVLTQGTTAEKVQLVVSCLGVVC
FT                   SIICLALGIAAAAVGVSCSGFAIGLGVIAILLGIVLFAISALDVLEDHGLVGCPFKLPC
FT                   KSSPTNEPTVQFFKGKNGSADKVILVTQ"
     atggaatgcg ttaaacagtt atgtagaaac catctatgtt tagacaactt gacgggtcct        60
     gtgcgctcgg tgttgacgca aggaacaact gcagaaaaag ttcagctagt ggtatcctgt       120
     ttaggagttg tttgttcgat tatttgttta gctttgggaa tcgctgcagc ggcagtgggt       180
     gtttcgtgta gtggatttgc tattggattg ggtgttatcg ccattctttt agggattgta       240
     ttgtttgcaa tatctgcttt ggatgttcta gaggatcatg gtttggtggg atgtccattt       300
     aagttgccat gcaaatcgag tccaactaat gaacctactg tacaattctt taaaggtaaa       360
     aatggaagcg cagacaaagt gattttagta actcaataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page