(data stored in SCRATCH zone)

EMBL: CP001887.PE134

CP001887.PE134       Location/Qualifiers
FT   CDS_pept        complement(149125..150402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00680"
FT                   /product="hypothetical protein"
FT                   /note="COG1295 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17822"
FT                   /protein_id="ADH17822.1"
FT                   /translation="MLRPPSFLKKLLSSVRNNFIIKSILKAPKVLYHNEASKEACVLSY
FT                   YGLFSCVPILVFFLRLSQYLFISLDWKEWLLLHFPDYKAPILAIIEAAYSTTSNIGVVL
FT                   VSSFFVFCWAGILMLQSLEDGLNKIFCSGITQASLKRLISYLVITLVSPMIFIIVCGSW
FT                   IYITQILPINYPQLFSFSHSMAFIYIVSRLLPYALLYGILFCCYAFLSRVPTKKSAAFF
FT                   AATIAGSAWILSQKIFFCLQLHLFNYSFTYGALVALPSFLLLLYLYAIIYLFGGALTFL
FT                   FQNKGFSILIPKEEIFPSSYFKFILCVYVLSLITEHFDNALPPPSANYLANKAKASIGE
FT                   TSQCLDILEREGMILKYKEGYKPSHNIANLHINTIFDQLTKSPAFSKICSPSLIPIQDA
FT                   LTHILTEIKKNSHNLSLSEIAKKVNS"
     atgttgcgcc ctccgtcttt tcttaaaaag cttctctctt ctgttcgcaa caatttcatc        60
     atcaaatcta tcctaaaagc tcctaaagtt ctttatcaca acgaggcttc taaagaagcc       120
     tgcgttctaa gctattatgg actattcagt tgtgttccta tattggtctt cttcctcagg       180
     ctttctcaat acctattcat tagtttagac tggaaagagt ggttactcct ccactttccc       240
     gattacaaag cgccgatctt ggcaattatt gaagcagctt actcaacaac tagcaatatc       300
     ggagtggttc ttgtcagtag tttctttgtc ttctgctggg caggtattct gatgctacaa       360
     tctttagaag atgggctaaa taaaatcttc tgttcaggaa tcactcaagc ttctttaaag       420
     agactaatta gctatctagt tatcactctt gttagcccca tgatctttat tattgtttgc       480
     ggatcttgga tctatattac acagattcta cctatcaact acccccaact atttagtttc       540
     agccattcca tggcttttat ttacattgtt tcacgattac ttccctatgc tcttctgtac       600
     gggattctct tttgttgcta tgcattcctc tctagagtcc ccaccaagaa atctgcagct       660
     ttttttgcag caactatagc tggtagtgca tggatcctct ctcaaaaaat cttcttttgc       720
     ctccagctcc acctttttaa ttatagcttc acttacggag ctctagttgc tttaccctct       780
     tttcttctcc ttctttacct ctatgctatt atctatttgt ttggaggagc cttaaccttc       840
     ttattccaaa acaaaggttt tagcatttta atccctaaag aagaaatttt cccaagtagc       900
     tatttcaagt tcattttatg tgtgtatgtt ctttccctaa tcacagaaca ctttgataat       960
     gctctccctc ctcccagtgc aaactatctt gctaacaaag ccaaagcttc tattggagaa      1020
     acctctcaat gtttagatat tttagaaaga gagggtatga ttcttaaata caaagagggc      1080
     tataagcctt ctcataacat tgcgaacctt catatcaaca ccatcttcga tcagcttact      1140
     aagtcccctg ctttttctaa aatctgctcc ccctctctta ttcctataca ggatgcgctg      1200
     actcatatac ttactgaaat caaaaagaac tcgcataacc tttccctttc agaaattgct      1260
     aaaaaagtga attcatga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page