(data stored in SCRATCH zone)

EMBL: CP001887.PE14

CP001887.PE14        Location/Qualifiers
FT   CDS_pept        13612..14952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00070"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17702"
FT                   /protein_id="ADH17702.1"
FT                   /translation="MSAEILARVQFALFIGFHYLFVPISLGLSMMIVLMEGLYLFTKKS
FT                   IYKQLTWFWIRIFTLTFVVGVVTGLMQIFSFGANWSRFAEYTGNVFGMFLGSEGMFAFF
FT                   LESGFLGVLLFGRYKVSKKMHFFSACMVALGAHMSAFWIVCANSWMQTPSGYEMVMRNG
FT                   MLVPQMTSFWAAVLSPSALQRFTHVVLGAWLSGIFLVLSVSAHYLRKERHKDFANQGLK
FT                   ISMFCAFLVLALQLWSADVTARGVAKHQPAKLAAFEGVFKTQGHTPIYLLGIVDMKKER
FT                   VIGIPIPSGLSLLVHRNAKTPVTGLDQFPKDEWPNVAFVFQTYHLMVMLWGVMVLLALI
FT                   AFAVYKKKSWSCKKGILWILSFSVLCPELCNEIGWISTEVGRQPWVVYGLLKTKDATSP
FT                   IVNAGQIWQSLILFSIIFICLLSVFVSLLLKKIGEGPDEQDLIEVDL"
     atgagtgctg agatattggc gagagtacag tttgcgttgt ttatcggatt tcattatctg        60
     tttgtcccca ttagtttggg attaagtatg atgattgttc ttatggaggg gctctactta       120
     ttcacaaaaa aaagtattta taagcagttg acctggtttt ggattaggat tttcacctta       180
     acttttgttg ttggcgttgt cacaggattg atgcagattt tttccttcgg agcaaattgg       240
     tctcgattcg cagaatatac tggaaacgta tttggaatgt tccttggtag cgagggaatg       300
     tttgctttct tcttagaatc tggatttcta ggagttttgt tatttggtcg ctataaagta       360
     tcaaaaaaaa tgcacttttt ttcagcctgt atggttgcgc tcggcgctca catgagtgct       420
     ttttggattg tttgtgcgaa ctcttggatg caaacgcctt ccggttatga aatggtcatg       480
     cgtaatggta tgttagttcc ccaaatgact tctttttggg cagcggtgtt gtctccttct       540
     gctttgcagc gttttacaca tgttgttctt ggcgcttggt tatctgggat atttcttgtt       600
     ctttccgtta gtgctcacta tctacgtaaa gagcggcata aagattttgc aaatcagggg       660
     ttaaaaatca gcatgttttg tgctttcctt gttttggctt tgcagctttg gtcagcagat       720
     gtcactgcaa gaggggtcgc taaacaccaa cctgccaagc ttgctgcgtt tgaaggtgtt       780
     tttaagactc aaggacacac cccaatttat ttactcggca ttgtagatat gaaaaaagag       840
     cgagtcattg ggatccccat tccttctggt ttatcgcttc ttgttcaccg aaatgcaaaa       900
     actcctgtta caggactgga tcagttccct aaagacgaat ggccaaatgt cgctttcgtt       960
     tttcaaacgt atcacttaat ggtcatgtta tggggagtaa tggtactttt agctctgata      1020
     gcctttgctg tgtataagaa aaaatcttgg agctgcaaga aggggatctt atggatactt      1080
     tccttctctg tgctatgtcc tgagttatgt aatgaaatcg gctggatttc tacagaggta      1140
     gggcgtcaac cttgggttgt ttatggctta ttaaaaacta aagatgcgac ctctcctatc      1200
     gtgaacgcag ggcaaatttg gcagtctttg atcctgtttt cgattatttt tatttgttta      1260
     ttaagtgtct ttgtctcgct tcttttgaaa aagataggtg agggaccaga tgagcaagac      1320
     cttatagaag tagatttgtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page