(data stored in SCRATCH zone)

EMBL: CP001887.PE144

CP001887.PE144       Location/Qualifiers
FT   CDS_pept        159056..159913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17832"
FT                   /protein_id="ADH17832.1"
FT                   /translation="MSDSDKIINDCRFDFNTTIHGDLLASNLTTEGDVTVKSISAKESF
FT                   SVKRNVDVNENDIIVNGFTGAAGYDLTTQGKISINLNGNRLSNVKRPEKDSQPVPANYI
FT                   RTPEYYFCSLQDGARIEWKRGQKLPLIGPSRLVYQSSRIDEFIRFVSFEEDKTKNQVKI
FT                   NLSGTTGLQMLAKGVYIINVGVGKRWGWNNGYGGDYCLAVPLGKEYSESSTFSRGGYYA
FT                   STAVGTAIHIRKESTNPDGPFSSSDTELMKTLLEVRYKGGDYVDKSALSTLYFGVLVYP
FT                   EIGG"
     atgagtgatt ctgacaaaat tattaatgat tgtcggttcg actttaatac aactattcat        60
     ggagatcttt tagcttcaaa tctgactacg gaaggggacg ttacggtaaa gagtatttcc       120
     gcaaaagaat ccttttctgt gaaaagaaat gttgatgtga atgagaacga catcattgtt       180
     aacggtttta ccggtgccgc aggatatgat ctgacaactc aaggcaaaat ttcaatcaat       240
     ctcaacggta atcgacttag taatgtcaaa cgcccggaga aagactccca accagttcct       300
     gctaactata ttcgtactcc tgaatactat ttctgctcat tgcaagatgg agcaagaatc       360
     gaatggaaac gggggcagaa gcttcctcta atcgggcctt cgcgcttggt gtatcaatcg       420
     tctcgtattg atgagttcat tcgttttgta tcgtttgaag aagataaaac taagaatcag       480
     gtgaaaataa atctctcagg gactacaggc ctgcaaatgc ttgcgaaagg tgtgtacatt       540
     atcaacgtag gagttgggaa gcgatggggg tggaataatg gatatggagg agattactgt       600
     ttagcggtcc ctttaggaaa ggaatacagt gagagctcta catttagtag aggaggatac       660
     tatgcttcta ctgctgtagg aacagcaatt catatcagaa aagagagcac aaatcctgac       720
     ggaccttttt cttcttcaga tacagaactt atgaagacac ttttagaggt gcgttacaag       780
     ggcggagact atgtggacaa gtccgccttg tccactttat attttggagt gctcgtatac       840
     ccagagatag gaggataa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page