(data stored in SCRATCH zone)

EMBL: CP001887.PE155

CP001887.PE155       Location/Qualifiers
FT   CDS_pept        complement(175765..178197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00790"
FT                   /product="MAC/perforin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17843"
FT                   /protein_id="ADH17843.1"
FT                   /translation="MTKPSFLYVIQPFSVFNPRLGRFSIDSDTYIEEENRLASFIESLP
FT                   LEIFDIPSFMETAISNSPYILSWETTKDGALFTILEPKLSACAATCLVAPSIQMKSDAE
FT                   LLEEIKQALLRSSHDGVKYRITRESFSPEKKTPKVALVDDDIELIRNVDFLGRAVDIVK
FT                   LDPINILNTVSEENILDYSFTRETAQLSADGRFGIPPGTKLFPKPSFDVEISTSIFEET
FT                   TSFTRSFSASVTFSVPDLAATMPLQSPPMVENGQKEICVIQKHLFPSYSPKLVDIVKRY
FT                   KREAKILINKLAFGMLWRHRAKSQILTEGSVRLDLQGFTESKYNYQIQVGSHTIAAVLI
FT                   DMDISKIQSKSEQAYAIRKIKSGFQRSLDDYHIYQIERKQTFSFSPKHRSLSSTSHSED
FT                   SDLDLSEAAAFSGSLTCEFVKKSTQHAKNTVTCSTAAHSLYTLKEDDSSNPSEKRLDSC
FT                   FRNWIENKLSANSPDSWSAFIQKFGTHYIASATFGGIGFQVLKLSFEQVEDLHSKKISL
FT                   ETAAANSLLKGSVSSSTESGYSSYSSTSSSHTVFLGGTVLPSVHDERLDFKDWSESVHL
FT                   EPVPIQVSLQPITNLLVPLHFPNIGAAELSNKRESLQQAIRVYLKEHKVDEQGERTTFT
FT                   SGIDNPSSWFTLEAAHSPLVVSTPYIASWSTLPYLFPTLRERSSATPIVFYFCVDNNEH
FT                   ASQKILNQSYCFLGSLPIRQKIFGSEFASFPYLSFYGNAKEAYFDNTYYPTRCGWIVEK
FT                   LNTTQDQFLRDGDEVRLKHVSSGKYLATTPLKDTHGTLTRTTNCEDAIFIIKKSSGY"
     atgactaagc cttctttctt atacgttatt caaccttttt ccgtatttaa tccacgatta        60
     ggacgtttct ctatagactc agatacttat atcgaagaag aaaaccgcct agcatcgttc       120
     attgagagtt tgccactgga gatcttcgat ataccttctt tcatggaaac cgcgatttcc       180
     aatagcccct atattttatc ttgggagaca actaaagacg gcgctctgtt cactattctt       240
     gaacccaaac tctcagcttg cgcagccact tgcctggtgg ccccttctat acaaatgaaa       300
     tccgatgcgg agctcctaga agaaattaag caagcgttat tacgcagctc tcatgacggt       360
     gtgaaatatc gcatcaccag agaatccttc tctccagaaa agaaaactcc taaggttgct       420
     ctagtcgatg acgatattga attgattcgc aatgtcgact ttttgggtag agctgttgac       480
     attgtcaaat tagaccccat taatattctg aataccgtaa gcgaagagaa tattctagat       540
     tactctttta caagagaaac ggctcagctg agcgcggatg gtcgttttgg tattcctcca       600
     gggactaagc tattccctaa accttctttt gatgtagaaa tcagtacctc cattttcgaa       660
     gaaacaactt catttactcg aagtttttct gcatcggtta cttttagtgt accagacctc       720
     gcggcgacta tgcctcttca aagccctccc atggtagaaa atggtcaaaa agaaatttgt       780
     gttattcaaa aacacttatt cccaagctac tctcctaaac tagtcgatat tgttaaacga       840
     tacaaaagag aggctaagat cttgattaac aagcttgcct ttggaatgtt atggcgacat       900
     cgggctaaaa gccaaatcct caccgaggga agcgtacgtc tagacttaca aggattcaca       960
     gaatcgaagt acaattacca gattcaagta ggatcccata cgattgcagc tgtattaatc      1020
     gatatggata tttccaagat tcaatccaaa tcagaacaag cttatgcaat taggaaaatc      1080
     aaatcaggct ttcaacgcag cttggatgac tatcatattt atcaaattga aagaaaacaa      1140
     accttttctt tttctccgaa gcatcgcagc ctctcatcca catcccattc cgaagattct      1200
     gatttggatc tttctgaagc agccgccttt tcaggaagtc ttacctgcga gtttgtaaaa      1260
     aaaagcactc aacatgccaa gaataccgtc acatgttcta cagccgctca ttccctatac      1320
     acactcaaag aagatgacag ctcgaacccc tctgaaaaac gattagatag ttgtttccgc      1380
     aattggattg aaaacaaact aagcgccaat tctccagatt cctggtcagc gtttattcaa      1440
     aaattcggaa cacattatat tgcatcagca acttttggag ggataggttt ccaagtgctc      1500
     aaactatctt ttgaacaggt ggaggatcta catagcaaaa agatctcctt agaaaccgca      1560
     gcagccaact ctctattaaa aggttctgta tccagcagca cagaatctgg atactccagc      1620
     tatagctcca cgtcttcttc tcatacggta tttttaggag gaacggtctt accttcggtt      1680
     catgatgaac gtttagactt taaagattgg tcggaaagtg tgcacctgga acctgttcct      1740
     atccaggttt ctttacaacc tataacgaat ttactagttc ctctccattt tcctaatatc      1800
     ggtgctgcag agctctctaa taaacgagaa tctcttcaac aagcgattcg agtctatctc      1860
     aaagaacata aagtagatga gcaaggagaa cgtactacat ttacatcagg aatcgataat      1920
     ccttcttcct ggtttacctt agaagctgcc cactctcctc ttgtagtcag tactccttac      1980
     attgcttcgt ggtctacgct tccttatttg ttcccaacat taagagaacg ttcttcggca      2040
     acccctatcg ttttctattt ttgtgtagat aataatgaac atgcttcgca aaaaatatta      2100
     aaccaatcgt attgcttcct cgggtccttg cctattcgac aaaaaatttt tggtagcgaa      2160
     tttgctagtt tcccctatct atctttctat ggaaatgcaa aagaggcgta ctttgataac      2220
     acgtactacc caacgcgttg tgggtggatt gttgaaaagt taaatactac acaagatcaa      2280
     ttcctccggg atggagacga ggtgcgacta aaacatgttt ccagcggaaa gtatctagca      2340
     acaactcctc ttaaggatac ccatggtaca ctcacgcgta caacgaactg tgaagatgct      2400
     atctttatta ttaaaaaatc ttcaggttat tga                                   2433
//

If you have problems or comments...

PBIL Back to PBIL home page