(data stored in SCRATCH zone)

EMBL: CP001887.PE161

CP001887.PE161       Location/Qualifiers
FT   CDS_pept        complement(184813..185553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17849"
FT                   /protein_id="ADH17849.1"
FT                   /translation="MARKPLVDRDHFPKYRTICDAIMEGNLENIRFSDKTGESVYSSKE
FT                   LPSVLFKRIGQKNAKQRVLNNIAVNACLAKIGVDGLQVLSASTYKDFLIEDKPFGKGAL
FT                   DTLIAYRLNPSLFDRAVKSLCKLFSFYHCPDLFVKSSDLLKDSPHSKLLLGFKENNESL
FT                   AAESATLQPILYLTGIQCILEEPTPDLEAKLSSLFPYHKTLIQQELSKLRVSKPKVEAS
FT                   KEPTPPSTYDERLNSSPYRNGKFL"
     gtggctagaa aacctttagt agatagagat catttcccca agtatcggac tatttgtgat        60
     gctattatgg aaggaaatct tgaaaatatt cgtttcagtg ataaaacagg cgaatcagtg       120
     tattcttcca aagaactacc ttccgtattg ttcaaaagaa ttgggcaaaa gaatgctaaa       180
     caaagggtgc ttaataacat cgcggtaaac gcttgtcttg cgaaaatagg cgtagatggt       240
     ttacaagtac tatccgctag cacttacaaa gatttcttaa tcgaagacaa accttttggt       300
     aaaggtgctc ttgatactct tatagcttat cgattgaatc catctttatt cgacagagct       360
     gtcaagagtc tgtgcaagct atttagcttt taccattgcc cggatctatt cgtaaaatcc       420
     agtgatttgc taaaagattc ccctcattcg aaactcctat taggtttcaa agaaaacaat       480
     gagtctcttg ctgcagaatc ggcgactctt cagcccattc tttatctcac agggatccaa       540
     tgtattcttg aagagcctac tccagatttg gaagcaaaac tctcttctct attcccgtat       600
     cataaaacat taattcaaca ggaattaagc aaactgcgag tttctaaacc gaaagtagaa       660
     gcctctaaag aacctactcc tccatctact tatgatgagc gcttaaacag ctctccctac       720
     agaaatggaa aatttttatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page