(data stored in SCRATCH zone)

EMBL: CP001887.PE165

CP001887.PE165       Location/Qualifiers
FT   CDS_pept        189320..190963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17853"
FT                   /protein_id="ADH17853.1"
FT                   /translation="MPDKNSEAGQNSLIQQGKYVDAIQKKLPASSQAQPKQAKAKEQKA
FT                   EEKPKTTPIEGVLETIKTEFKGHRVPVEKIIHGIWIAGAPPDGIEDYMRVFLDTYEGFD
FT                   FYFWVDENAYAAAKFSSILKKVAFDAAIQDLRSATDESTKAFVKDYDELKQKYEKKVAE
FT                   TTSQAEKDQYLKDLKDLLEKFTKISDEIRGKFDRLFLKNVIVAQNGFFNFCLLKGLGNI
FT                   NDETRAEYLEKELKLPTEEIEQYKKLKETNKEKIAAIVKQLNEKLGSDRVKIKDIKELQ
FT                   SMKQARNVYNYEQEMFLRWNYAAATDQIRMYMLEELGGLYTDLDMMPSYSQEVLELIKK
FT                   HSDGNRMFEDMSSRRAISDAVLKMAVGKATTVSMEEVAKDIDVSRLTEEDKTKLNALFK
FT                   DLEPFAKPDSKGAEAEGGEGAKGMKKSFFQPIDLNIVRNTMPILRRYHHYPELGWFIRG
FT                   LNGLMVSHKGSTAVSAVIVGQQAAYQELAALRQDVLSGEFFHSLENLTHRNHKERIGNH
FT                   LVANYLAKSLFFDYCQDSVMPEAVSTLGIR"
     atgccagata aaaattcgga agcgggacag aattccttga ttcaacaagg aaaatacgtc        60
     gatgccattc agaagaagct tccagcatca tcgcaggctc agcctaaaca ggcaaaagct       120
     aaggaacaga aagccgaaga aaaacctaag acgactccga ttgaaggtgt tcttgaaacc       180
     atcaaaacag aatttaaagg ccatcgtgta cctgttgaga aaatcatcca tggaatatgg       240
     atcgcaggag cgcctccgga tggtatcgaa gattatatgc gagtcttttt agatacttat       300
     gaaggttttg acttctactt ctgggtagat gagaatgctt atgcagcagc taaattttct       360
     agcattttga agaaggtcgc tttcgatgcg gctattcaag atctacgatc tgccacagat       420
     gagtctacga aggcctttgt taaagactac gatgaattaa aacagaaata tgaaaagaaa       480
     gttgcggaga cgacttctca agcagaaaaa gaccaatatc tcaaagatct aaaggatctt       540
     ttagagaaat ttacaaaaat cagtgatgag attcgtggaa aatttgatcg gctgtttctt       600
     aagaatgtga ttgttgctca gaacggattc tttaatttct gcttgctgaa aggcctcggc       660
     aatatcaatg acgaaacgcg tgcagagtat ttagagaaag aactcaaact tcctactgag       720
     gagatcgaac agtataaaaa gcttaaagag acgaacaaag agaagatagc cgctattgta       780
     aaacaactaa acgagaaact tggatcggat cgggtaaaaa tcaaagacat taaagagctg       840
     caatctatga agcaagctcg aaatgtctac aattatgaac aggaaatgtt tctgcgctgg       900
     aactatgcag ccgcaacaga tcagattcgt atgtatatgt tggaggaact tggaggtctt       960
     tatactgatc tggatatgat gccttcatac tctcaggaag tattggagct tatcaaaaag      1020
     cacagtgatg gaaaccgaat gtttgaggat atgagctcta gacgggcgat ttctgatgcg      1080
     gttttaaaga tggctgtagg taaggcgaca acagtttcca tggaagaggt agcaaaggat      1140
     atcgatgttt ctcgcttaac agaagaggat aagacaaaat taaacgctct atttaaggat      1200
     ctagagccat ttgcaaaacc ggattctaaa ggagctgaag cagaaggggg tgaaggagca      1260
     aaaggtatga aaaagagctt tttccagccc atagatctga atattgtcag aaataccatg      1320
     cctatcttga gacgctatca tcactatcct gagttaggat ggtttattcg aggattgaac      1380
     ggattgatgg tctctcataa gggaagcact gcggtttctg ctgtcattgt agggcaacag      1440
     gctgcctacc aggaactagc agcacttaga caagatgtcc tttcagggga gtttttccat      1500
     tctttagaaa atttgacaca tagaaaccat aaggagcgta ttggaaatca tctcgtcgct      1560
     aattatttgg ctaaaagtct cttttttgat tactgccaag attcagtgat gccggaggct      1620
     gtaagtacct taggtattag atga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page