(data stored in SCRATCH zone)

EMBL: CP001887.PE181

CP001887.PE181       Location/Qualifiers
FT   CDS_pept        complement(202105..202797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00930"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17869"
FT                   /protein_id="ADH17869.1"
FT                   /translation="MLDVKSLYYSHASHSVFEDASASFASGQISMVLGASGSGKTTLFR
FT                   IIAGLLSCSLGEILWKGQPIQQEQIAYMQQKEALLPWRTVRKNILLLTELGSRKQKTTI
FT                   EEECFYNVVHSFGLSSLLDRFPDELSGGQRQRVVFAMQSLSPKPILLLDEPFTSLDPIT
FT                   KEILYQDVKRLAKEEGKTIILASHDVQDCLGVGEAFFAIKNQKLHSIALNKEQGIAGLL
FT                   QQMKDHLV"
     atgctagacg taaaatctct gtattattct catgcatctc actctgtttt tgaagatgca        60
     tcagctagct ttgcttctgg tcagatttct atggttctgg gggcttctgg aagtggtaag       120
     actacattat ttaggatcat agcaggtctt ctctcttgtt ctttaggaga aattctctgg       180
     aaagggcaac ctatacagca ggagcagata gcctacatgc agcaaaagga agctttgtta       240
     ccctggcgca ccgttagaaa aaatatttta ttgttaacgg agttaggatc gcgcaaacag       300
     aaaacaacta ttgaagaaga atgtttctac aatgttgtgc attctttcgg gctatcttca       360
     ttgttagatc gatttccaga tgaattatct ggaggacagc gtcaacgtgt tgtgtttgct       420
     atgcaaagct tatctccaaa gcctattttg ctgttagatg agcctttcac gtctttggat       480
     cccattacga aagaaatttt ataccaagat gtgaaaagat tagccaaaga agaaggaaag       540
     acgatcatac tagcttcgca tgatgtgcaa gattgtttag gagttgggga agcctttttc       600
     gcgatcaaga atcagaaact ccattcaatt gccttaaata aagaacaagg aatcgctggg       660
     ttattgcagc aaatgaagga ccacctagtt tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page