(data stored in SCRATCH zone)

EMBL: CP001887.PE234

CP001887.PE234       Location/Qualifiers
FT   CDS_pept        259897..260244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01195"
FT                   /product="inclusion membrane protein B"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17922"
FT                   /protein_id="ADH17922.1"
FT                   /translation="MVHSVYNSLAPEGFSQVSIQPSQIPTSKKVMIAIMTLFALTAIAA
FT                   IVLSIVTVCGGFPFLLAALNTVTIGACVSLPVFTCIATTLLLLCLRNIELLARPQVFTL
FT                   STQFSPTKPQE"
     atggttcatt ctgtatacaa ttcattggct ccagaaggtt ttagccaagt ctctattcaa        60
     cccagtcaga ttccaaccag caaaaaagta atgattgcga taatgactct ttttgcactc       120
     acagccattg cagcaatagt cctttccatc gttacagttt gtggagggtt tccttttctt       180
     cttgctgcac ttaacaccgt aactattggt gcatgcgtat ccttgccggt attcacttgc       240
     atagctacaa cgttattact tctttgtctc cgtaatatcg aactcctagc cagaccgcaa       300
     gtatttaccc tctccactca attcagccca acaaaacctc aagaatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page