(data stored in SCRATCH zone)

EMBL: CP001887.PE236

CP001887.PE236       Location/Qualifiers
FT   CDS_pept        260915..263701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17924"
FT                   /protein_id="ADH17924.1"
FT                   /translation="MLLFYKGSGSLRALRFLLSLRRGEEKRALLFLLLGLIWSVACYGS
FT                   LALGESLFLEEIGAEKLPFAYLGASFFLCFISCLILYNLSRKRVSPKALFLSFISCVLI
FT                   CNLYLFWHLAIHKGVSGTPTFLYRILIWGLTILCYANFWGFIDQFFNIQDAKRHFCIFN
FT                   AITFCGDFLGARIVNQIQYLGAELILLAFIVVITFIFPLVHYISSSLKELSEDHNLFLD
FT                   TGYPPSTKQTLKLCLKDKYTFYLVSFYFLMQLLVVFTEFNYLKIFDAQFGNAETCELTE
FT                   NFTKYSSWISLGNMFFALFAYSRVITRFGINNIILFAPICFFSLFCCWSIKTSVFIATM
FT                   GMIAREGLAYALDDNNLQLLIYGIPNKIRNQVRIAIESFVEPAGMFICALLCLFIPHQY
FT                   VLCIIISAVCILLAILLRTHYSKAILRNLSLESIHRRRSIREWFADMNDTEKRQAEILL
FT                   LTHLKNPQERNQMFAFQHLLNLKNRAVLPNLLLHMNKLGLSGKLKTLNMLKNSVWAKDF
FT                   LTLELLKRWSSLPQHPTIAAALHLYFVEHDLLHVSDIADDLYDQSGDRLFAAVLIVRKH
FT                   KPSGEYQALAEKHLSEILESEDPELIIKGLSILALERSPSNFPIILPFLTHPNEQVFLQ
FT                   ACLSLETCADKQYAQYGRTVLNTLKKTKDTQAAQALLNTLAALLDASLVYEFVLASVQL
FT                   KNVLRKLAETILASLPKECIPILIEMVADHSLHNSCRIMAAKALSHIDSRQLKRLALKI
FT                   LKSKAAKTLFYDYHKNFIQKRYPRYDLHLLIESLEANYQAEVNFMLAFLAIVGSSDYAD
FT                   VLIRSLTGKNLKARAQALESLEKDCENHLFTLVTPFVYRDKHTSDEKYYMKKGVEPLAI
FT                   EELLNRLEQTPFLFSKLIAQQLKEELSLCDAEFSSALQSFAKKQKTSILSREYITSS"
     atgcttcttt tctataaagg aagcggatcg ttgcgagcct tgcgtttttt gcttagtttg        60
     cgtcgcggag aggaaaagcg agctctatta tttcttctat tggggctcat ctggagcgtc       120
     gcctgctacg gttcccttgc tctgggggag agcctgtttt tagaagaaat tggagctgag       180
     aagctgccct ttgcctattt gggagcatcc ttctttcttt gcttcatttc gtgtttaatt       240
     ctctataacc tctctcggaa gcgagtctct ccaaaggctc tctttctttc gttcatatct       300
     tgcgttctaa tctgcaacct ttaccttttt tggcatctag ccatacacaa gggtgtttct       360
     ggcactccga cttttctcta taggatcctt atatgggggc tgacaattct ttgttatgcc       420
     aatttttggg ggtttataga tcaatttttt aatatccaag atgccaaacg tcatttttgc       480
     atttttaatg ccattacatt ttgtggagat tttttagggg cacgtatcgt caaccagatt       540
     cagtatctcg gagccgagct aattctcctc gcttttattg tcgtaattac tttcatattc       600
     cctctggtac actacatttc atcgtcacta aaagagcttt cagaagatca caatctcttc       660
     cttgatactg gctatccccc ttctaccaaa caaactttaa agctgtgttt gaaggataaa       720
     tacacctttt acttggttag tttttatttt cttatgcagc ttcttgtcgt attcacagag       780
     ttcaattatt taaaaatctt tgatgcacag tttggaaacg ctgagacttg tgagttaaca       840
     gagaatttca ctaagtactc ctcctggatt tccttaggaa atatgttctt tgccttattt       900
     gcttatagcc gagtaatcac aagatttgga atcaataaca tcattctctt cgctcccatc       960
     tgcttcttta gcctattctg ttgttggtca attaaaactt ctgtcttcat agcaacaatg      1020
     ggaatgatcg ctagagaagg gcttgcttat gctttggatg ataataatct acagttatta      1080
     atctatggca tccctaataa aatccgaaat caggtgcgga tcgcgataga atcttttgtt      1140
     gagcctgcgg ggatgttcat ctgcgcacta ctatgtttat tcatcccgca ccaatacgta      1200
     ctctgtatta tcatttccgc cgtgtgtatt cttttagcaa tattgctacg cactcactat      1260
     tcaaaagcca ttcttagaaa tctctctcta gaatcaatac atcgtagacg ttctatacgc      1320
     gaatggtttg cggatatgaa tgacactgaa aaacgccaag ctgaaatcct tctgctaacg      1380
     catttaaaaa atcctcaaga acgcaaccaa atgtttgcgt tccaacactt gttgaaccta      1440
     aaaaatcgcg cagtactccc caacctactt cttcacatga acaagttggg cttatcaggg      1500
     aaattaaaaa ccctgaatat gttaaaaaat agcgtatggg cgaaagattt cctcactctc      1560
     gaactactaa aacgttggag cagccttccc caacatccga ccatagcagc agctcttcac      1620
     ctctattttg tagagcatga cttgcttcat gtttccgata ttgctgatga tctttatgat      1680
     cagtctggag accgtctatt tgcagctgtt ctcatcgtaa gaaaacataa gcctagtgga      1740
     gaataccaag ctcttgccga aaaacatctc tcagaaattc tagaatctga ggatccggag      1800
     ttaataatta aaggtctttc tatcttagct ttggaaagaa gcccttcaaa cttccctatt      1860
     atcctcccct tcttgacgca tcctaatgaa caagtatttc tacaagcctg cttatctcta      1920
     gaaacttgtg cagataaaca atatgctcaa tacgggcgga cggttctcaa tacactgaaa      1980
     aagacaaaag acacacaagc tgcacaagct ttactgaaca ctctagctgc cctcttggat      2040
     gcatccctag tctatgagtt cgttcttgcc tcagttcaac tcaaaaatgt cttacgcaaa      2100
     ctagcagaaa cgattctagc ctctcttcct aaagaatgta ttccaatttt aattgaaatg      2160
     gtcgcggatc attctctaca caatagctgc cgcattatgg cagcaaaggc tttgagccac      2220
     atagatagtc gtcaactaaa acgtttagct ttgaaaattt taaagtctaa ggctgctaaa      2280
     actttattct acgactacca taaaaacttt atccaaaaac gctaccctcg ctacgatctc      2340
     catctgctta ttgaaagcct ggaagcaaat taccaagctg aagtcaattt tatgttagcc      2400
     tttttagcca tcgtcggctc atcagattat gcagatgttt taattagatc tcttacaggg      2460
     aaaaacctaa aagctagagc tcaagcttta gaatctctag aaaaagattg cgagaaccac      2520
     ttgtttactc ttgtcacacc ttttgtatat cgcgataagc atacttccga cgagaaatat      2580
     tatatgaaaa aaggtgtgga accattggct attgaagaac ttctgaatcg tctcgaacaa      2640
     acccctttcc ttttcagtaa gcttatagct cagcaactaa aagaagagct ttctctttgc      2700
     gatgcagagt tttcttctgc tctacaaagc tttgctaaga aacaaaaaac ctctatatta      2760
     tcccgggaat acataactag ttcctag                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page