(data stored in SCRATCH zone)

EMBL: CP001887.PE244

CP001887.PE244       Location/Qualifiers
FT   CDS_pept        271037..271558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01245"
FT                   /product="Outer membrane protein"
FT                   /note="COG2825 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17932"
FT                   /protein_id="ADH17932.1"
FT                   /translation="MKKFLLLSLMSLSSLPTFAANSTGTIGIVNLRRCLEESALGKKES
FT                   AEFEKMKNQFSNSMGKMEEELSSIYSKLQDDDYMEGLSETAAAELRKKFEDLSAEYNTA
FT                   QGQYYQILNQSNLKRMQKIMEEVKKASETVRIQEGLSVLLNEDIVLSIDSSADKTDAVI
FT                   KVLDDSFQNN"
     atgaaaaagt tcttattact tagcttaatg tctttgtcat ctctacctac atttgcagct        60
     aattctacag gcacaattgg aatcgttaat ttacgtcgct gcctagaaga gtctgctctt       120
     gggaaaaaag aatctgctga attcgaaaag atgaaaaacc aattctctaa cagcatgggg       180
     aagatggagg aagaactgtc ttctatctat tccaagctcc aagacgacga ttacatggaa       240
     ggtctatccg agaccgcagc tgccgaatta agaaaaaaat tcgaagatct atctgcagaa       300
     tacaacacag ctcaagggca gtattaccaa atattaaacc aaagtaatct caagcgcatg       360
     caaaagatta tggaagaagt gaaaaaagct tctgaaactg tgcgtattca agaaggcttg       420
     tcagtccttc ttaacgaaga tattgtctta tctatcgata gttcggcaga taaaaccgat       480
     gctgttatta aagttcttga tgattctttt caaaataatt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page