(data stored in SCRATCH zone)

EMBL: CP001887.PE263

CP001887.PE263       Location/Qualifiers
FT   CDS_pept        292934..293632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01340"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="COG0847 DNA polymerase III, epsilon subunit and
FT                   related 3'-5' exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17951"
FT                   /protein_id="ADH17951.1"
FT                   /translation="MPALIFYDTETTGTQIDKDRIVELAAYNGTTSESFQTLVNPEIPI
FT                   PAEATKIHGITTAEVADAPRFPEAYQKFIEFCGTDNILVAHNNNAFDYPLLVRECRRHG
FT                   LSEPQLRTIDSLKWAKKYRTDLPQHSLQYLRQVYGFEENQAHRALDDVITLYRVFSALV
FT                   GDLSPDQIYDLLNETCHPRIFKMPFGKYKGKPLSEVPSSYIAWLQKGDYLLQPENKEIK
FT                   AAIEAYQQLK"
     gtgccagctt taatttttta tgatacagaa acgacaggta cgcagataga taaggatcgt        60
     atagtggagc tagctgctta caacgggact acgagcgagt ctttccaaac gctagtaaac       120
     cctgaaatcc ctatacctgc tgaggcaact aaaattcatg gtattacgac tgcggaagta       180
     gccgacgccc ccagattccc agaagcttat cagaaattta tcgaattttg tggtacagat       240
     aatattcttg tagctcacaa taacaatgct ttcgattatc ctctgttagt tcgtgaatgt       300
     cgtagacacg gcttatctga gcctcagctt cgtactatag attcgttaaa atgggcaaaa       360
     aaatatcgaa ccgacttgcc tcagcatagt ctccaatacc ttcgtcaggt atacggattc       420
     gaagaaaatc aagcgcaccg agcattagat gacgtaatca ctctttatag agtattttca       480
     gctttagtgg gggatttgtc tcctgatcaa atttatgatc tactaaatga gacttgtcat       540
     cctcgcatat ttaaaatgcc tttcggtaag tataaaggga aacctctttc tgaagtcccc       600
     tctagttaca tcgcctggtt acaaaaaggt gattacttgc tacaaccaga aaataaagaa       660
     attaaagcag ccattgaggc ctatcagcaa ttgaaatga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page