(data stored in SCRATCH zone)

EMBL: CP001887.PE265

CP001887.PE265       Location/Qualifiers
FT   CDS_pept        294392..294982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17953"
FT                   /protein_id="ADH17953.1"
FT                   /translation="MFKLLLIFADPAEAARTLSLFPFSLNKENFYTYHTENVLLDVMVL
FT                   KTWGYRGVVQALSPPPGGYDLWINAGFAGAGNPNIPLLKTYTITSVKELTPTTSVEEEL
FT                   EVTPIPRLPLAQLTSVRSPYRDGFHEHLQLVDMEGFFIAKQASLVACPCSMIKVSSDYT
FT                   TREGQDFLKNNKVKLSQKLAEAIFPIYSSFIDV"
     atgtttaagc tccttcttat ttttgctgat ccggcagaag ctgctagaac actctctctg        60
     tttccttttt ctcttaataa ggagaacttt tatacctacc atacagaaaa cgttctgtta       120
     gatgttatgg tactaaaaac atggggttac cgaggagttg ttcaagcatt aagcccccct       180
     ccaggtggat atgacctgtg gataaatgca ggatttgccg gagcaggcaa tccaaacata       240
     cctcttctta aaacttatac gattacctct gtaaaagaat taactccaac aacttctgtg       300
     gaagaagaac ttgaagtaac ccccatccct agactccctc tagcacaatt gacatcagtc       360
     agatctccgt atagagatgg gtttcatgaa catttacagc tagtcgatat ggaaggattt       420
     ttcatagcaa aacaggcttc gttagtagcg tgcccatgtt ctatgattaa agtatcttct       480
     gactacacta cgcgggaagg acaagacttc ttaaaaaata acaaagttaa gctctctcaa       540
     aaattagcgg aggctatctt tccgatatat tcctcgttta ttgatgttta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page