(data stored in SCRATCH zone)

EMBL: CP001887.PE266

CP001887.PE266       Location/Qualifiers
FT   CDS_pept        complement(295003..296943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01355"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17954"
FT                   /protein_id="ADH17954.1"
FT                   /translation="MKLLLKAILRHKKHLVLFGFSLLSILGLTITSQAEIFSLGLIAKT
FT                   GPDTFLLFGKQEGASLVKRKELSKDQLLEQWDNIVGEGDTLSLPQANAYIAKHSGGSQS
FT                   ITKRLSAYLSGCFDFSRLQCLALFLVVVAILKSTTLFFQRFLAQLIAIRVSCSLRKDYF
FT                   LALQTLPMTFFHAHDMGNLSSRVIADSSMIALAINALMVNYIQAPITMTLALVVCLSIS
FT                   WKFCACVCLAFPIFILPIVIIAKKVKALAKRIQKSQDHSAAALLDFLLGILTVKVFRTE
FT                   QFSFSKYCQKNDEIARLEERSAAYSLIPRPLLHTIASLFFALVIMIGLYHFHIPPEELV
FT                   VFCGLLYLIYDPIKKFADENANIMWGCAAAERFYEVLDLSKQQSNVSEKLNEFQGLQHS
FT                   IQFCNVSFGYVEDSPVLSDFNLVLKKGEAIGIVGPTGSGKSTIAKLLPRLYEVSHGELL
FT                   IDSLPIQSYCKNSLRKHIGCVLQHPFLFYDTVWNNLTCGRTFSEEEVFHALKQAHAYEF
FT                   VSKMPQGVHSLLEESSKNLSGGQQQRLTIARALLHNTSILLLDEATSALDAISENYVKE
FT                   IVGQLKGRCTQIIIAHKLSTLEYVDRIVYLEQGKKIAEGTKEELLDSCPAFQRMWVLSG
FT                   AKDWELNAVVK"
     atgaaacttc ttctgaaagc gattctgagg cataagaagc atttagtttt attcggtttt        60
     tctcttttat ccatattagg gctaacgata acgtctcaag cagaaatttt ttctctaggt       120
     cttattgcta agacaggtcc tgatacgttt cttctttttg ggaagcagga gggagcttcc       180
     ttagtcaaaa ggaaagagct gtccaaagat caacttcttg aacagtggga taatattgtt       240
     ggtgagggag acacgctatc tttgcctcaa gcgaatgctt atattgcgaa acattcagga       300
     ggctctcagt caataacaaa aaggctttcc gcctatctct ctggttgttt tgacttttct       360
     cgtttgcaat gcctcgcgct ttttctagta gttgttgcta ttttgaaatc aacaacgcta       420
     ttttttcaga ggtttttagc acaattaatt gctattcgtg tgagctgctc tttacgtaaa       480
     gattacttct tagctttaca aacgctcccg atgacattct ttcatgcaca cgatatgggg       540
     aatctaagta gtcgtgtgat agcagattca tctatgattg cattagctat taatgccctt       600
     atggtgaatt acattcaggc tcctatcact atgactttag ccttagtagt gtgcttgtct       660
     atttcttgga aattttgtgc ttgtgtttgt ttagcgttcc ctatttttat tttgccaatt       720
     gttatcattg caaagaaagt taaagcattg gctaaacgaa ttcaaaagag tcaagatcat       780
     tctgccgctg cgttattgga ttttctttta ggtattctta cagtaaaagt atttagaact       840
     gagcagtttt cttttagtaa gtattgtcag aaaaatgatg agattgctcg attggaagag       900
     cgcagtgctg cgtatagttt aattccaaga cctcttctgc acactattgc ctcgttgttc       960
     tttgctttgg tcattatgat cggtttgtat cattttcata tcccacctga ggagcttgtg      1020
     gtcttttgtg ggcttttgta tctcatttat gatccgatta aaaagtttgc tgatgaaaat      1080
     gcgaatatca tgtggggatg cgctgctgca gaacggtttt atgaagtatt ggatctatca      1140
     aagcagcagt ccaatgtttc tgaaaagtta aatgaattcc agggattaca acatagtatt      1200
     cagttttgca atgtatcctt tggatatgta gaggatagtc ccgtattatc agatttcaac      1260
     ttagtattaa aaaaagggga ggctatcggt attgttggtc caacaggatc tgggaaatct      1320
     accatagcaa agttattgcc aaggctttat gaagtctctc atggcgaact gttaattgat      1380
     tcacttccga tacaaagcta ctgcaaaaat tctttaagga aacatattgg ttgtgtgctg      1440
     cagcatccat ttttattcta tgatacggtg tggaataacc tgacttgtgg cagaaccttt      1500
     tcagaagaag aagtatttca tgctttaaag caagctcatg cctacgaatt tgtttctaaa      1560
     atgcctcaag gcgtgcacag cttattagag gaatccagta aaaatttatc tggaggtcag      1620
     cagcaacgtt tgacaatagc tagagcattg ctgcataaca cctccattct gttgctagat      1680
     gaggcaacat cagcattgga tgccattagc gaaaattatg ttaaagagat agtcgggcag      1740
     ttaaaaggcc gttgtacaca aattatcatt gcccacaagc tctccactct cgaatacgta      1800
     gatcggattg tttacttgga acaagggaag aaaatagcag aaggaaccaa agaagagtta      1860
     ttagactctt gcccagcttt tcaaagaatg tgggtcttat cgggtgctaa ggactgggaa      1920
     ctcaatgctg tcgtaaaatg a                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page