(data stored in SCRATCH zone)

EMBL: CP001887.PE276

CP001887.PE276       Location/Qualifiers
FT   CDS_pept        306275..306694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01405"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17964"
FT                   /protein_id="ADH17964.1"
FT                   /translation="MLDNEWKAILGWGDEELEELRISGYSFLRQGHYQKAILFFEALVI
FT                   LDPLSVYDFQTLGGLYLQISENTKALYVLDQALRMQGDHLPTLLNKTKALFCLGRIEEA
FT                   SAIASYLTSCPDPIIADDAEALLLSYVKPPLVAVR"
     atgttagata atgagtggaa agcaatttta ggatggggag acgaagaact cgaagagctc        60
     cgcatttctg gatattcgtt ccttcgtcaa gggcattatc agaaagctat tctttttttt       120
     gaagctctcg ttatcttaga ccctctaagt gtatatgatt tccaaacact aggaggactc       180
     tatttgcaga ttagcgaaaa taccaaagct ctttatgtct tggatcaagc tttacgtatg       240
     caaggagatc acctccctac cctgctcaat aaaactaaag ctctattctg tctcggacgc       300
     atagaagaag catcagcgat agcttcctac ttaacgtcgt gtccagatcc tatcattgca       360
     gacgatgccg aagcattact acttagttat gtaaaacccc ccttggttgc tgttcgataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page