(data stored in SCRATCH zone)

EMBL: CP001887.PE283

CP001887.PE283       Location/Qualifiers
FT   CDS_pept        312662..313396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01440"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit E"
FT                   /note="COG2209 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase, subunit NqrE"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17971"
FT                   /protein_id="ADH17971.1"
FT                   /translation="MWLGDYSLLNLLGIFLQATFIQNILLSTFLGMCSYLACSSRLSTA
FT                   NGLGMSVALVLTITGSINWLVHYFITKPGALAWLSPALANIDLSFLELIMFIVVIAAFT
FT                   QILEVLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYPFLPMVVFSLGSGCGW
FT                   WLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGIDISKPTTSKPAFV
FT                   TNIATDSPQPNTHSSSEEPKAS"
     atgtggttgg gagactattc tttattaaat ctcttaggga tctttttaca agccacgttt        60
     attcagaata ttttgctgtc cacattttta ggaatgtgta gctatttggc ctgttcatct       120
     cgcttgtcaa cagccaacgg cttggggatg tctgtggctc tcgtgcttac aattacagga       180
     agcattaact ggttggtaca ttattttatc acaaaaccgg gcgccttggc ttggttatca       240
     cctgcattag caaatattga tctcagcttc ctagaattaa tcatgtttat tgttgttatc       300
     gcagcattca cacaaatttt agaagtactc ctcgaaagat tttccagaaa cctttaccta       360
     gctttgggaa tatttcttcc ccttattgca gtaaactgcg ctatcctagg tggagtatta       420
     tttggaatta ctcgaaacta tccttttcta cctatggtgg tattctcctt gggctcagga       480
     tgtggctggt ggcttgcgat cgttcttttt gcaactatta gagaaaaatt agcttactcc       540
     gatgttcctc aacacttacg agggacaggg atttccttca ttacgacagg actgatggct       600
     atggctttta tgggattaac aggaattgat atttccaaac ccacaacatc taaacctgca       660
     tttgtcacga atatagccac tgatagccca caaccaaata cacattctag ctcagaagaa       720
     cccaaggctt cataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page