(data stored in SCRATCH zone)

EMBL: CP001887.PE313

CP001887.PE313       Location/Qualifiers
FT   CDS_pept        348760..349470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18001"
FT                   /protein_id="ADH18001.1"
FT                   /translation="MKRVILCSLLFASLPIVSKAAVEGKPLSRAAQLRERRKDLHVSGK
FT                   PSPRYALKKRALEAKKNKPSISWITYSNSTYSFLIPNTWQCIDDKTQLPEKLDVLFIGK
FT                   GAGGLTPTINSAHEIIHKTEDAYIEEILDYHRTNENTLESSIFAHIQAHSSNFTIIKTE
FT                   KNTSWGRVFCLQGVTVIDHTAYVLTSTSTIDDYPNVSLALLKAASSFRLSEKEEAARGD
FT                   AILEKALKDLQNGK"
     atgaaaagag ttatcctctg ctctctttta tttgcaagtc tccctatagt ttcgaaggca        60
     gccgtagaag gaaagcctct ttctagagct gctcaattac gagaaagaag aaaagatctc       120
     catgtatcag ggaagccctc tcctcgttat gctttgaaaa aacgtgcttt agaagctaaa       180
     aaaaataagc cttctattag ctggataacc tattccaatt ctacctattc ctttcttatc       240
     cctaatactt ggcagtgcat cgatgataaa acgcagctac cagaaaaatt agatgttctt       300
     ttcattggga agggagcagg aggactgacg ccaacaatca acagcgcaca cgaaatcatc       360
     cataaaactg aagatgccta tattgaggag attttagact atcatcgcac gaatgaaaac       420
     acactggaat cttctatctt tgcgcacatt caagctcaca gcagcaattt tacaattatc       480
     aaaacggaaa aaaacacctc ttggggacga gtcttttgcc tccaaggtgt gacagtcatt       540
     gatcacacag cctacgtcct tacaagcacg tctaccatag atgactatcc caacgtctcc       600
     ttagctcttc taaaagcagc ctcctccttt agactctcag aaaaagaaga agctgctcgt       660
     ggtgatgcca ttttagaaaa agctttgaaa gatctgcaaa atggaaaata g                711
//

If you have problems or comments...

PBIL Back to PBIL home page