(data stored in SCRATCH zone)

EMBL: CP001887.PE350

CP001887.PE350       Location/Qualifiers
FT   CDS_pept        395262..395627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18038"
FT                   /protein_id="ADH18038.1"
FT                   /translation="MQLPSIIQSFFFPKAPPSPLKKPIYQQTERIINIAYLVLLSLSVV
FT                   GIISGVFLSLSFPLLGAGICLISLAVGSCLLVLFPLLPDIEKIIARREPKVSITTSSPL
FT                   PTLMRYFKSIGLGKAAH"
     atgcaacttc cgtctattat tcagtctttc ttcttcccta aagctccccc atctccactt        60
     aaaaaaccta tttatcaaca aactgaacgc atcatcaata tagcttatct tgttctgtta       120
     tccctatccg ttgtaggaat tatctctgga gtattccttt cccttagctt ccccctatta       180
     ggcgcaggca tttgtttaat ctctttagcc gtaggttcct gcctacttgt tttgtttcca       240
     ttgctcccgg atattgaaaa aataattgct cgaagagaac ccaaggtctc gattacaact       300
     agctccccat taccaacatt aatgcgctac ttcaaatcga ttggccttgg aaaagcagct       360
     cattag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page