(data stored in SCRATCH zone)

EMBL: CP001887.PE360

CP001887.PE360       Location/Qualifiers
FT   CDS_pept        complement(406155..407216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18048"
FT                   /protein_id="ADH18048.1"
FT                   /translation="MRVVERAVIACYLGITIFSGIAFGYEGAFSSGSFEQNPSGVAIHN
FT                   RVLFKVDEDTVVTTLDVIRKLNILFYSTCPQLVDSVSARSQYYSAMWPVVLETVINEFL
FT                   MAADAKAKKIFIDPTSVNQEIEAMFGRDLSPFAKFFDMTPEDVFNVVHRILVAQRVEGM
FT                   MVRSRVMLKVTPGMVREYYQKLADEAAQITQWTYRVLTIKAGLEFLAHKIAGKVQERLN
FT                   EGSSWDKERLTALVLSQGGQLMCSEEFFREDAQLSVAHRQSLEEINFPEERCGKVLEHA
FT                   SGLKLFVLFNRATKTLDPLDKMEAQLKQQLMMEFAAEEEANYKNKLHARYGFDPATITK
FT                   LLAEDAPQLFSLL"
     atgcgagtag tggaacgtgc tgttatagct tgctatctag ggatcacgat tttttctgga        60
     atcgcttttg gctatgaggg agctttctcg tctggttcct ttgagcaaaa tccttctgga       120
     gtagccatcc ataatcgggt gttatttaag gtagacgaag acactgtcgt cacgacttta       180
     gatgtgattc gcaagttgaa tattcttttt tactcgactt gcccgcagtt ggtagattct       240
     gtatctgcaa gatctcaata ttattctgct atgtggcctg tggttctgga aacggtaatt       300
     aacgagtttc tcatggctgc agatgctaag gctaagaaga tttttataga ccctacctca       360
     gtgaatcaag agatagaagc gatgttcggt cgtgatttgt ctcctttcgc gaagtttttt       420
     gatatgactc cggaagacgt ttttaacgtt gtacatcgga tcttagtagc tcagcgcgta       480
     gaaggaatga tggtacgctc acgtgtgatg ttaaaagtaa ctccggggat ggtgcgagag       540
     tattatcaaa agcttgctga cgaggctgcc cagattacac aatggacgta tcgggtattg       600
     actattaagg ctggtttgga gtttttagca cacaaaattg cagggaaagt tcaagagcgt       660
     ctaaatgaag gctcttcttg ggataaagag cgattgactg cgctggtcct ttctcaaggg       720
     gggcagttga tgtgctcaga agaattcttc cgcgaggatg ctcagttgtc cgttgcgcac       780
     cgacaatctt tagaagagat caattttcct gaagagcgat gtggaaaggt tctcgaacat       840
     gcgtctgggt tgaaactttt tgtattgttt aatcgtgcta caaaaacttt agatcccctt       900
     gataagatgg aagctcagtt gaagcaacag cttatgatgg agtttgcggc ggaagaagag       960
     gctaactata aaaataagtt acatgctcgg tacggatttg atccagctac aataactaaa      1020
     cttcttgcag aagatgctcc ccagctattt tctttattat aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page