(data stored in SCRATCH zone)

EMBL: CP001887.PE362

CP001887.PE362       Location/Qualifiers
FT   CDS_pept        complement(409953..410207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01840"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18050"
FT                   /protein_id="ADH18050.1"
FT                   /translation="MEILIQEAPDRWFGIFESEVVEGETGAYSKTEGFCTTGICFYYQT
FT                   KKFVNSLGREGLEEVSSSKPLHFTKKAYLPRLIKVKGYR"
     atggagatct tgatacaaga ggctccagat cggtggtttg gtatttttga atcagaagtc        60
     gtagaaggag aaacaggagc gtactccaaa actgaaggtt tctgtactac aggcatatgt       120
     ttctactatc aaactaaaaa atttgtaaat tctttaggaa gagagggatt agaagaagtc       180
     tcttcctcca aacccctcca ttttaccaaa aaagcgtatt taccacgcct aataaaggta       240
     aaaggttaca gataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page