(data stored in SCRATCH zone)

EMBL: CP001887.PE364

CP001887.PE364       Location/Qualifiers
FT   CDS_pept        410450..410986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01850"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18052"
FT                   /protein_id="ADH18052.1"
FT                   /translation="MATPITVPPSSASSQSSPDVSPHLSSASAKNAIYNTKQGRPWPVI
FT                   VSQIALLIMRISSIIVLGLGIAFLASNPMLGWSLLIAAITLAISSLLCAIAISVYQTLT
FT                   IRKLQSEVSSLERQSGVIFIEEGVEDALLSFESPFAGLEDDLVSPISPPLSPGDRSYID
FT                   HLVMQAEARSLEEHC"
     atggctacac cgattactgt accgccttct tcagcgtcat cacaatcttc tccggacgtt        60
     tccccacatt tatcttccgc ttctgctaaa aatgcaatat acaacactaa acagggaaga       120
     ccttggcctg tcatagtaag ccaaatcgct cttttaatta tgagaatttc ctctattatt       180
     gtgcttggat taggaatagc gtttctggca tcgaatccta tgttaggatg gagcctgctt       240
     attgcagcga ttaccctagc gatctcttct ctattatgtg ctattgcaat ctccgtctac       300
     cagactctaa ctatccgaaa attacaaagc gaagtctcct cactagaacg ccagtctggc       360
     gtcatcttta tagaagaagg tgtcgaagac gcccttctat cctttgagag tccattcgca       420
     ggattagaag atgacctcgt atctcctatc tctccaccac tctctcctgg ggatcgctct       480
     tatatagatc atctggtgat gcaagccgaa gctagaagcc tcgaagagca ctgctaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page