(data stored in SCRATCH zone)

EMBL: CP001887.PE39

CP001887.PE39        Location/Qualifiers
FT   CDS_pept        complement(42310..42666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17727"
FT                   /protein_id="ADH17727.1"
FT                   /translation="MESFFVLKIPFFLLNGVQDSPCLSLVLFYSFFPFTLNWFATLGGR
FT                   PTAPRNSVLIQLKLKKILSTTLVIQESPNTKKAPREYTVRGDFSKLLNFGIIEASEIRK
FT                   VPMKSALHCTLRED"
     atggagtctt tttttgtttt gaaaatacct ttttttctgc taaatggagt tcaagatagt        60
     ccctgtctct ctctcgtcct tttttattca tttttcccgt tcaccctcaa ttggtttgca       120
     actcttggtg gtagaccaac tgcaccgcga aatagcgttc taattcagct aaaattaaaa       180
     aaaattctat cgaccactct cgtaatacag gaaagcccaa atactaaaaa agctccaagg       240
     gagtatactg tccgaggcga cttttctaaa ctcctcaatt ttggcatcat tgaggcctca       300
     gaaatacgaa aagtccctat gaaaagtgcg ttgcattgca ctcttagaga ggattaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page