(data stored in SCRATCH zone)

EMBL: CP001887.PE399

CP001887.PE399       Location/Qualifiers
FT   CDS_pept        complement(447305..448438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18087"
FT                   /protein_id="ADH18087.1"
FT                   /translation="MSSIQGTSGSSPERLPNSREDEGMNPEGVTPSGQTISFSAVGKST
FT                   SAEDIQQLALPIIQSDAMASSPSVGGAVGEVEVAEIIADVMEKNDANVQKLDEDMEALL
FT                   QAISSSEEQLESPGVRNKSALKGTNRSNSHREEIARNQRLRSLSVRHGLAYNRHSLRRL
FT                   ARGIRHHAGLVTASFATLHKTLRAVPQEDLKSILGKDSDTVLARLHKLGLEVNEKGEWR
FT                   LRANGEVGSINQSICNLARSAERLHDDGPLSINDQASEEEVTACCSAGRRACQFLQEHL
FT                   MGALRAIYYQILRFFHWISRRVEVEPEDTDYYMRPGIFINPYASYLSSSPSVEDPRSLR
FT                   DRLRDGGALSGEDTLFSMPQDESLDSESVSDDDRGFQ"
     atgtcttcta tacaaggaac atcgggttct tcccctgaga ggcttcccaa ttctagggaa        60
     gacgagggga tgaatcccga aggggtcaca ccctctggtc agactatttc tttctctgct       120
     gtagggaaga gtacctctgc agaagatatt cagcagcttg cacttccgat tattcagtcg       180
     gatgcaatgg catcttctcc aagtgtggga ggagcagttg gcgaggttga agtcgctgag       240
     atcatcgcgg atgtaatgga gaagaacgac gcgaacgtgc agaaactgga tgaagacatg       300
     gaagctctac tgcaagcgat ttcttctagt gaagagcagc tagagtctcc tggggtaaga       360
     aataagagcg ctctgaaagg aacgaatcgt tctaattctc atcgagaaga gatagctaga       420
     aaccagagac tccgctccct ttctgttcgt catgggcttg cgtataaccg acattcatta       480
     agaagattag ctagaggaat acgtcatcac gcaggactag taaccgcgtc ttttgcaaca       540
     ctacataaaa cgcttcgtgc agttcctcaa gaagatctca agtccatttt aggtaaggat       600
     agcgatacgg ttctagctcg cttacataag ttaggattag aggtcaatga gaaaggggag       660
     tggagacttc gagccaacgg agaggtcggc tctattaatc aatctatctg caacttagct       720
     cgttctgcgg aacgtttaca tgatgacgga cctttgagca tcaatgacca agcttctgaa       780
     gaggaggtaa cggcatgctg ttctgcagga agaagagcct gtcagttttt gcaagagcat       840
     ttaatgggtg ctttgcgagc catttactac cagatcttgc gtttctttca ttggatatcg       900
     aggagggtag aggttgagcc tgaggacaca gactattaca tgcgtccagg catattcatt       960
     aacccttacg cgtcgtattt aagttctagt ccttctgtgg aagaccctcg ttctctacgg      1020
     gaccgcttgc gggatggggg agctctgtcc ggagaggata ctctattctc tatgcctcaa      1080
     gatgagagtt tagattcgga atccgtttcc gatgatgata gaggatttca atag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page