(data stored in SCRATCH zone)

EMBL: CP001887.PE486

CP001887.PE486       Location/Qualifiers
FT   CDS_pept        546343..546537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18174"
FT                   /protein_id="ADH18174.1"
FT                   /translation="MKNQLTLIGLFTTSKKPLSLQIPIYFKEKIGGFIRENSYPLYLSI
FT                   CPYSNKVSAKAYPLIVRNH"
     atgaagaatc agcttactct gattggactc tttactacaa gtaaaaaacc tctcagctta        60
     caaattccta tctattttaa agaaaaaatt ggaggattta tcagagaaaa ctcttatcct       120
     ctctatctca gtatctgccc atactcaaac aaagtctctg caaaagccta tccccttatt       180
     gtaagaaacc actga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page