(data stored in SCRATCH zone)

EMBL: CP001887.PE489

CP001887.PE489       Location/Qualifiers
FT   CDS_pept        complement(547636..548565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18177"
FT                   /protein_id="ADH18177.1"
FT                   /translation="MGIEGRGSGAMQSKKTIKWLKQALVLSSIVNILLLLLIYSTVFRK
FT                   DIYKLRVFPGNLIAKSSRIGKIPEDILERLENASFADLLALLQEERMVFGHPLKSWALG
FT                   VSIQKYFVDIAPMLTHPLTFIRLKSPERTWLLPDINDQEFTRICQYLLTERFPFSSRGF
FT                   FRIMVRDCEAGMVDEDVLYRFCHLPEFLYVRSLLFGAEIEAASVASLARMIIQGGEDLF
FT                   FSLCCLENRQTAISDHQRRCFLKAYVDRQEPLAALLLLVHDADWVLHEFSDSDLQSFIQ
FT                   LLPREAHYTKKFLGCVAQSCRLGILLEG"
     atggggatag aaggaagagg atcaggagct atgcaaagta aaaaaacgat taaatggctg        60
     aagcaagctc tcgttcttag ttctattgtg aatatcctat tactgctttt gatttattcg       120
     accgtattta gaaaagatat ttataaatta cgggtttttc cagggaatct catcgctaaa       180
     agttcacgaa tagggaagat tcctgaagac attttggaaa gactagaaaa tgcttcgttt       240
     gccgatttat tagccttgtt gcaggaagag agaatggttt tcggccatcc attaaaatct       300
     tgggctctag gggtgagcat ccaaaaatat tttgtagata tcgctcctat gctgacgcat       360
     cctttaactt ttattagact caaaagtcct gaacgtactt ggttacttcc ggatattaat       420
     gatcaggagt ttacacggat ttgtcagtat ttgcttacag agaggttccc attctcttca       480
     cgaggttttt ttcgtattat ggtgcgtgat tgtgaagcag ggatggtgga tgaagatgtt       540
     ctgtatcggt tttgtcatct tcctgagttt ctctatgtgc gttctctcct ttttggtgcg       600
     gaaatcgaag ctgcttcggt cgcttctctg gcaagaatga ttatccaagg aggggaggac       660
     ttattctttt ccctgtgttg tttagaaaat cgtcaaacgg cgatttctga tcatcagagg       720
     cgctgttttc tgaaagctta tgtggataga caggaacctt tagcagctct tctcttgtta       780
     gtacatgacg cggactgggt gttgcatgag ttttctgata gcgatttaca atcctttatt       840
     caacttttgc ctagagaggc acactatact aagaagtttc ttgggtgtgt ggcacagtcc       900
     tgtcgtctgg ggattctgct agaggggtag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page