(data stored in SCRATCH zone)

EMBL: CP001887.PE494

CP001887.PE494       Location/Qualifiers
FT   CDS_pept        complement(554253..555731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02505"
FT                   /product="hypothetical protein"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18182"
FT                   /protein_id="ADH18182.1"
FT                   /translation="MLRYILKRLLLIPLTLFAIISVNFVILNAAPGDLLEEHSVDAQGE
FT                   AGRSDKVRTYKGPDRYLQFREHYGLTLPIFFNTRPQISRSELRAGIQEIIDGTIHKKSK
FT                   TGSITNIKVYWGDCAKFIMPALLAEAEDSSKEDIYRHVAADLFIRGGIRQGIVGARLLE
FT                   EQREYNQKVSKSNAELVRLLNEDNIEVKVAALQEWVEQEGGRGQLMRRDLWRIFFLETR
FT                   FAKYLSRIVRLDFGTLRNDCHKTVVSEVIKRLGSSLILSLLPMIVVFILCQVFGMIMAV
FT                   NKNHWIDHLLNFLFLILFSIPVFVAVPWIIDNFVLNKTVPFTSISMPYSGLCSSPEIFK
FT                   EMTSFEKLTDIVLHSFLPFCAVSYGAFAAQSRLSRAVFLEVLGEDHISALRARGISQYD
FT                   ILVRHVGKNSAATLITSLASSLSALLGGALVVETLFDIDGFGKFFYQAILNRDHNVVMF
FT                   SVIMGSVISLIGYLIGDICYVLLDPRVQLEERKV"
     atgctccgct atatcttaaa acgtctgctt ttgattccct taacgctctt tgctatcatc        60
     tctgtgaatt ttgtgattct caatgctgct ccaggagacc tgcttgagga acatagtgtg       120
     gatgcccaag gtgaggctgg gagatcggat aaggttcgta cgtataaagg gccggaccgt       180
     tatttacaat ttagagagca ttacggatta actctcccta ttttttttaa tactcgacca       240
     cagatttctc gatcggaact ccgtgctggg attcaagaga ttattgatgg gacgattcac       300
     aagaagagta agacaggaag cataaccaat attaaggtgt attggggaga ttgtgccaag       360
     ttcattatgc cggcgctgct tgcagaggct gaagattctt cgaaagagga tatttatcga       420
     catgttgcag cagatttatt cattcgagga ggtattcgtc aggggattgt tggagcacgt       480
     ttgctggagg aacagcgcga atataatcaa aaagtgtcta aaagcaatgc agaactcgtg       540
     cgtttattga atgaagataa tatcgaagtt aaagttgccg cgttacaaga atgggttgag       600
     caagagggcg gaagggggca attaatgcga agagatctct ggaggatctt tttcttagag       660
     acgcggtttg ctaagtacct ttctcgtatc gttagattgg attttggaac gttacgcaac       720
     gactgtcata agacggtcgt ttctgaagtg atcaaacgtt taggttcgtc acttattcta       780
     tccctgcttc ctatgattgt ggtttttata ttatgccaag tgttcggtat gatcatggct       840
     gtgaataaaa accattggat agatcatctt ctcaattttc tatttttgat tttattttct       900
     attcctgtct ttgttgctgt cccttggatt attgataatt tcgttctaaa taaaacagtt       960
     ccatttacgt ccatttctat gccttacagt ggactgtgtt catctccaga aatattcaaa      1020
     gaaatgactt cttttgaaaa gctgacggat attgtgttac acagtttctt gcctttttgt      1080
     gctgtcagtt acggagcttt tgctgcacag tcacgtttaa gtcgtgctgt atttttagaa      1140
     gtcttaggag aagaccatat ttcagctctt cgagctcgtg gtatttctca gtatgacatt      1200
     ttggttcggc atgtggggaa aaactctgca gctacgttaa tcacttcttt agcctcgtct      1260
     ttaagcgcac tacttggagg agctttagta gtggaaacac tatttgatat cgatggtttc      1320
     gggaaatttt tctatcaggc gattctaaat cgtgatcaca atgtggtgat gttttccgta      1380
     attatgggat cggtgatttc tctgatcggt tacttaatcg gggatatttg ttacgttctt      1440
     cttgatccac gtgtacagct agaagaaagg aaggtgtga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page