(data stored in SCRATCH zone)

EMBL: CP001887.PE498

CP001887.PE498       Location/Qualifiers
FT   CDS_pept        complement(559126..559287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_02525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18186"
FT                   /protein_id="ADH18186.1"
FT                   /translation="MHSSSPISEICSMETAERVLEEKEHTPTIISGQIVIYPEDPFAIP
FT                   SVDPCFES"
     atgcatagct cctcccccat ttctgaaatc tgttctatgg aaacagcaga gcgagttctt        60
     gaagaaaaag agcatacccc tactattatt tcaggccaga tagtgattta cccagaagat       120
     ccttttgcaa ttccctcagt tgatccatgc ttcgagtctt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page