(data stored in SCRATCH zone)

EMBL: CP001887.PE608

CP001887.PE608       Location/Qualifiers
FT   CDS_pept        663513..665465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03085"
FT                   /product="sigma regulatory family protein-PP2C phosphatase"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18296"
FT                   /protein_id="ADH18296.1"
FT                   /translation="MTIPIHENKYSMISFTRTIGFRLWLICVAAIMFPLGINILQLNLQ
FT                   QYKKTLSSITSDLRENALFKAHTLQQTIPLNIDILALFSEIFDLDRGVPAEPDLALSKE
FT                   MEKIFHSTYKEISLVKKEADGNFRVVASSRIEQLGKNYNQEIFLSDSQPFLATLRHSGS
FT                   DSQVLAVLQTNIFDISSQEVLGVLYTLSDTNYLLNGLLAAKDPLSVKTAILSKNGIILQ
FT                   ATDSSLDLVSIHKTVSKEQFCDVFLRDDICPPHLLLRPPLNLDPLPYGENFVSFCIGNT
FT                   EMWGYIHSLPEMDFRILTYEEKSIIFASLWRRTLLYFAYFCCVLLGSITAFLVAKRLSK
FT                   PIRKLATAMMETRRNQHHPYEPDSLGFEINHLGEIFNSMVQSLLQQQSLAEKNFEIKQH
FT                   AQNALRLGEEAQQCLLPNQLPDSPTTEIAKAYIPAITVGGDFFDIFVIGEGPQAKLFLI
FT                   VADASGKGVNACAYSLFLKNMLHTFLSELSSIQEAVQQTAALFYQQTAESGMFVTLCIY
FT                   CYHYATRELEYYSCGHNPACLRAPNGDISFLSHPGMALGFLPEVPPHPAYTLVLEEESL
FT                   LVLYTDGVTEASNKHGEMFGEERLKALVASLTKQSAEEAIQSIMFSIKSFVKDCPQHDD
FT                   ITLLVLKIPKEPSAY"
     atgaccatcc ctattcatga gaataaatat tccatgatct ccttcacacg cacgataggt        60
     tttcgtttat ggcttatctg tgtggccgct attatgttcc ccttagggat caatatcttg       120
     caattgaacc ttcagcaata caagaaaaca ctctcctcta tcacttccga tctgcgagaa       180
     aatgctttat ttaaagctca cactttacaa caaactattc ctttaaatat tgatatcctg       240
     gctctctttt cagaaatttt tgatctagac agaggagtcc ctgctgaacc ggatcttgct       300
     ctaagtaaag aaatggagaa gatctttcac tccacttata aagagatttc tctagtaaaa       360
     aaagaggctg atgggaactt tagagtcgtt gcttctagcc gcatcgaaca acttggtaaa       420
     aactataacc aagagatttt cctatcagat tctcaaccat ttctcgctac tttgcgacat       480
     tccggttccg attctcaggt tctggctgtc ttacaaacga atatttttga tatcagctct       540
     caagaagtcc ttggcgtact ctataccctt tcggatacca actatttatt aaatggatta       600
     cttgcagcta aagatcctct ctccgtaaaa actgcaattc tctctaaaaa tggcatcatt       660
     cttcaagcaa cagattcctc tttagatctt gtatcgatac acaaaacggt ttctaaagag       720
     caattttgtg atgttttcct tcgcgatgat atctgccccc ctcatctctt actacgcccc       780
     cctttaaatc tcgatcctct tccttatggc gagaatttcg tttcattttg cattgggaac       840
     acagaaatgt ggggatatat ccactctcta cctgagatgg atttccgtat attgacttat       900
     gaagaaaaat ctataatttt tgcttcttta tggcgacgaa ccttactgta ctttgcttat       960
     ttttgttgcg tacttttagg aagcattaca gcttttttag ttgcaaaacg cctatccaag      1020
     cctatccgga agctggctac ggccatgatg gaaactcgtc gcaatcaaca ccatccatat      1080
     gaacccgatt ctctgggctt tgaaattaat catctaggag aaatctttaa ctccatggtg      1140
     caaagccttt tgcaacagca atctttagca gaaaaaaatt tcgagatcaa acagcatgca      1200
     caaaatgcat tacgactagg agaagaagct caacaatgcc tgcttcctaa ccagctgcct      1260
     gattccccaa ctacagaaat cgctaaagcc tatattcctg caattacggt aggaggagat      1320
     ttctttgata tctttgttat aggcgaaggt ccccaagcta aactctttct aatcgttgct      1380
     gatgcttccg ggaaaggagt caatgcgtgc gcctactcct tattcctgaa aaacatgtta      1440
     catacctttt tgagtgagct ctcctctatt caagaagccg ttcaacaaac agctgctctc      1500
     ttctatcaac agacagctga atctgggatg tttgtaacac tatgcattta ttgttatcat      1560
     tacgcaacac gagaactaga atactattct tgtggccaca acccagcgtg tctccgagct      1620
     cctaatggag atatctcttt cctgtcgcat cctggtatgg ccttaggatt tttacctgaa      1680
     gttcctcctc accctgctta cactctcgtt cttgaagagg agtctctttt agtgctctat      1740
     accgatgggg tgactgaagc aagcaataag catggagaga tgtttggaga agaacgctta      1800
     aaagcattag tggcttcgtt gacgaaacaa agtgccgaag aagccatcca atctatcatg      1860
     ttctctatta agtcttttgt gaaagattgc ccacaacatg acgatatcac tttactcgtt      1920
     ttgaaaatac ctaaggaacc ttccgcttat tag                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page