(data stored in SCRATCH zone)

EMBL: CP001887.PE654

CP001887.PE654       Location/Qualifiers
FT   CDS_pept        718223..718477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18342"
FT                   /protein_id="ADH18342.1"
FT                   /translation="MKTLIDNNIVRFKNISKTKQGIFVNFQVKGERGGASFTASIAVDI
FT                   DAADVSAGDSLETIIERCALIGIREFQKCEFQFEGIICL"
     atgaaaacgt taattgataa caacatcgtc agattcaaaa atatttctaa aaccaaacag        60
     ggtattttcg ttaattttca agttaaagga gagagagggg gggcttcctt tacagcttct       120
     atagccgttg atatcgatgc agctgatgtt tctgcaggag attctttaga aaccattata       180
     gaacgctgtg ctcttattgg tattcgggaa tttcaaaaat gcgagtttca gtttgaagga       240
     attatttgtt tataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page