(data stored in SCRATCH zone)

EMBL: CP001887.PE662

CP001887.PE662       Location/Qualifiers
FT   CDS_pept        727066..728076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03355"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="COG1792 Cell shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18350"
FT                   /protein_id="ADH18350.1"
FT                   /translation="MNTLGPYHKRVRFITYLFVAFGIIVSWNLPRSAYESIQDTFVRVC
FT                   SKFLPFRQGSDSLALVEETQCFLLKEKIRLLEERILSMEEAKQSPPLFSEILSSYFQSP
FT                   IMGRVIFRDPAHWGSSCWINIGKRQGVKKNSPVVCGKVVVGLVDFVGEAQSRVRFITDV
FT                   GIKPSVMAVRGEIQTWVVKDQLRTLARNVANLPASAFADSDKQEALHLLQALEDSLSLS
FT                   EQNDFALRGIVCGRGDPIWKPEASILSGSDFGFVDGKTIEVGDVLVTTGLDGVFPPGLL
FT                   VATVNEVLPKSEGSCSLKIKAQSLAPDCSTVDFLVLPPMDFNPNDRPDIFGLIWE"
     atgaataccc tcggtccgta tcataaacgc gttcggttca ttacgtatct ttttgttgcc        60
     ttcgggatta ttgtgagttg gaatcttcct cgaagtgctt acgagtctat ccaggataca       120
     ttcgttcggg tgtgttccaa atttcttcca tttcggcaag ggtctgattc tctggccctt       180
     gttgaagaaa ctcaatgctt tttattgaaa gaaaaaattc gtttattgga agagcgtatt       240
     ctttctatgg aagaggcaaa acagtctccg cctttgtttt cagaaattct atcctcgtat       300
     tttcaatctc ccattatggg aagagttatc tttcgagatc cagcacactg gggtagttct       360
     tgttggatta atataggaaa gcgacagggc gttaaaaaga attctcctgt tgtttgcggt       420
     aaggttgttg tggggttggt ggattttgtt ggtgaagcgc agtctcgtgt acgattcatc       480
     accgatgtgg gtatcaaacc ttctgttatg gcggttcgtg gtgaaattca aacttgggtt       540
     gtgaaagatc agctacgtac attagctagg aacgtcgcta atcttccggc atctgctttt       600
     gcagatagtg ataaacagga agctttacat ctcttgcagg ctctagagga ttctttatct       660
     ctatcagaac aaaatgattt tgctcttcgt ggaattgttt gtggtcgtgg ggatcctatt       720
     tggaaaccgg aggcttctat acttagcggt agcgattttg gttttgtaga tgggaaaact       780
     atcgaagttg gagatgttct tgtgaccaca ggattggatg gtgttttccc tccaggactt       840
     ctcgttgcta cagtcaatga agttcttcct aaaagtgaag gatcttgttc tttgaagata       900
     aaagcacaat ccttagctcc agattgttct acggtggatt ttttggtgtt accaccaatg       960
     gattttaatc ctaatgatcg tcctgatatt tttggtttga tttgggagta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page