(data stored in SCRATCH zone)

EMBL: CP001887.PE663

CP001887.PE663       Location/Qualifiers
FT   CDS_pept        complement(728092..731172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03360"
FT                   /product="exodeoxyribonuclease V beta chain"
FT                   /note="COG1074 ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18351"
FT                   /protein_id="ADH18351.1"
FT                   /translation="MSSFDIFSPTASVSGKFFLEASAGTGKTFTIEQVVLRSLLEGSIE
FT                   QTKNILVVTFTNAATNELKLRIQASLKQALSLFSQALSHPGTPLPPYISSSETKVKQLY
FT                   MKIRNSLATLDEMNIFTIHGFCRFTLEQHFPWIQPIQPSSIFSEPQTIQQHILDYLRKN
FT                   LWDTVLSPKQYAFLSYHHRATTQQTRHLIERLLQDYTSTPNLALSPLSITLQKLKAWVS
FT                   RYQHLAPLSLEEMQAFSLRFKQSDLSIERELPAFVQQFETNPYSLDMLFFPGMVQKFQE
FT                   ENRNKKKLSAPASPLDPFFQDWIQLAHPFCQKEPIFHTLLKSVQQHLKTHCAQSYSHDE
FT                   SIATLESLLAHNDTVVSQLRKQFQLVLIDEFQDTDKRQWQIFSKLFASPDYSGSLFLIG
FT                   DPKQSIYEWRNADLPTYLQAKHSFPKEAQLILDTNYRSTPELMQALNHLFSLPTPFLET
FT                   PQNILYHPLHSKGSAEISYSEFSPIHFFSSEDIQEETLWISKTASYLRSAYSIPFGNMA
FT                   VLVQDYPQALKLITHSTIPMAYCKEKRIFDRTESPYLLILLLEALLYPENQQKIQAILM
FT                   SRLFQLSSTEIHQHLKTFSSLFFTLNRHLYHYSLLATFYKLMGENVLSQTIGETLLQTP
FT                   LGDIIFQELEALCLYLDKTTENPHHKLLHLINILITGKYDEELSFSSQSNDENMIKITT
FT                   VHSSKGLEYDVVFCSCLNKAKEKTPSVHMREMYVACTRAKKFLFIPFSPIEKRSLSTKK
FT                   LSALANYANVTKHHSVPHLVETLTSSSPELFSSSFQPPESSLTPDRERLPQQTYFSLPH
FT                   LPSRTIHSFSSTVENLHFSEPIQELPPSLLFPGGSLTGTLIHKLLESLAGNFAACFEEI
FT                   FNKAQTLLKNTPLEGYESIIAEKICTVFSTTLPFSSGSFALRNVHPHNIRAEETFLLQE
FT                   EGELWQGIVDLFFEHKDRFFIIDWKTSFLGDETSCYSPDQLHLYIQRQGLDRQERLYRK
FT                   AAKRFLHQFNSLLQVEMAFVFIRGLDDKGNGFLQPGR"
     atgagctctt ttgatatttt ttcaccaaca gcttctgttt ctgggaaatt tttcttagaa        60
     gcttctgcag gaactgggaa aacattcact atagaacaag tggttcttcg ctcgttatta       120
     gaaggatcga tcgaacagac aaagaacatt ctggtagtta cattcaccaa cgcagctacc       180
     aatgaattaa aactgcgtat tcaagcaagc ctcaaacaag cattgagtct tttctcccaa       240
     gcactctctc atcccgggac tcccttacct ccctatatct cttcctcaga aacaaaagta       300
     aaacagcttt acatgaagat ccgtaatagc ctggccactt tagatgaaat gaacatcttt       360
     actattcatg gattttgtcg ttttacactg gagcaacact tcccttggat acagcctatt       420
     cagccgtctt ctattttctc agagcctcaa accatacaac agcatatcct agactactta       480
     cgtaaaaatc tttgggacac ggttctctct cccaaacaat acgccttctt atcttatcat       540
     caccgcgcta ctacccaaca aacacgccac ctaatagaga gactacttca agattacact       600
     tccacaccaa atttagcgct ctcgcctcta tcgataaccc tgcaaaaact aaaagcttgg       660
     gtctcccgct accaacactt agctcctctc tctctcgagg aaatgcaagc tttctctctt       720
     cgttttaaac aaagcgatct ctctatcgag cgggaactcc ccgcttttgt gcaacaattc       780
     gaaaccaatc cttattcttt ggatatgctg tttttcccag gaatggtaca gaagtttcag       840
     gaggaaaacc gcaataagaa aaaattaagt gctccagctt ctcctttaga tccttttttc       900
     caagattgga tacagttagc tcatcctttt tgccaaaaag aacctatttt ccatacgcta       960
     cttaaaagcg tgcaacaaca tctgaaaact cactgcgcac aatcctattc ccatgatgaa      1020
     agcatagcca ctttagaatc tcttctagct cacaacgata ctgtcgtctc acaactacgt      1080
     aaacaatttc agctagtctt gatcgatgaa ttccaagaca ctgacaaacg tcagtggcag      1140
     atcttttcta aactctttgc ttctccagac tattcaggat ccctttttct tatcggagac      1200
     cctaaacagt ctatttatga atggagaaat gcagacctcc ccacatactt gcaagcaaaa      1260
     cactccttcc caaaagaagc tcagcttatt ttagatacaa attaccgatc caccccagag      1320
     cttatgcaag ctctcaacca tttgttttct cttcccacac cgtttctaga gactccacaa      1380
     aacattctgt atcacccttt acattctaaa gggagcgcgg agatctccta ctcagagttc      1440
     agtcctattc atttcttctc ctcagaagac attcaagaag aaacgttatg gatttctaaa      1500
     accgcttctt atcttcgatc agcgtattcc attccatttg gaaatatggc tgttctagta      1560
     caagactatc cacaggctct gaagctaatc actcacagca ccatccccat ggcctactgc      1620
     aaagaaaaac gtatttttga tcgcacagaa tccccctacc ttctgattct actattggaa      1680
     gcccttctgt acccagagaa tcaacaaaag attcaagcca ttttgatgag ccggctattt      1740
     cagctttcct ctacggagat tcaccagcat cttaaaacgt tttcttcttt gtttttcact      1800
     ctgaatcgac atctctacca ctattctcta ttagctacct tctataagct gatgggagaa      1860
     aacgttttat ctcaaaccat aggagaaaca ttattgcaaa cccctcttgg agatatcatt      1920
     ttccaagaat tagaagcgct atgcttgtat cttgataaaa ctacagagaa tccccatcac      1980
     aaactcttac atctcatcaa tattctgatt acagggaagt atgatgaaga gctttctttc      2040
     tcgtcgcaat ctaatgacga gaatatgata aaaattacga ccgttcactc ttcaaaaggg      2100
     ctcgaatacg atgtagtatt ttgctcttgc cttaacaaag caaaagagaa aactccttct      2160
     gttcatatgc gagaaatgta tgtcgcatgc acaagagcca aaaaattctt atttattccg      2220
     ttttctccta tagagaaacg ctcactaagc acaaaaaaac tttctgctct tgctaactat      2280
     gctaatgtta caaaacatca tagcgttcct catttagtag aaaccttgac ttcctcatct      2340
     ccggaactat tttcatccag cttccaacct cctgaaagct ctctaactcc ggatagagaa      2400
     cgtcttcctc aacaaacata cttttctctt ccacatctcc cttctcgaac tattcactct      2460
     ttctcttcta cggtagagaa tcttcacttt tcggaaccta ttcaagaact gccaccctct      2520
     cttttatttc ctggaggctc tctaacagga acgttgattc ataaactttt agaatcatta      2580
     gcagggaatt ttgctgcttg ttttgaagaa attttcaata aagctcagac attattgaaa      2640
     aacactcctt tagaaggata cgagtctatt attgcagaaa aaatctgtac ggtcttttca      2700
     acgactcttc ctttttcttc cggatccttt gctctcagga atgtacatcc tcataacata      2760
     cgtgcagagg aaactttctt actacaagaa gaaggagagc tatggcaagg aatcgtcgac      2820
     ttgttttttg aacataagga tcgatttttt atcatcgact ggaaaacttc tttcttagga      2880
     gatgaaacct cttgctattc cccagatcaa ctccatctct atattcaacg tcaagggtta      2940
     gatagacagg agagattgta cagaaaagca gcgaaaaggt tcctacacca atttaattca      3000
     ttattgcaag tagaaatggc cttcgtattt atccgaggct tggatgacaa gggcaatgga      3060
     tttttgcaac caggacgtta a                                                3081
//

If you have problems or comments...

PBIL Back to PBIL home page