(data stored in SCRATCH zone)

EMBL: CP001887.PE68

CP001887.PE68        Location/Qualifiers
FT   CDS_pept        complement(76723..78309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00340"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17756"
FT                   /protein_id="ADH17756.1"
FT                   /translation="MTQTAEKPFGKLRSFLWPIHMHELKKVLPMFLMFFCISFNYTILR
FT                   DTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVFMLIYAKLSNILNKQALFFAVLSPFVV
FT                   FFALFPVVIYPCRHILHPTAFADTLQSILPSGFMGFIAMLRNWTFAVFYVLSELWGSVM
FT                   LSLMFWGFANEITKISEAKRFYALFGVGANVALLISGPAIIWSSKLRASLGEGVDPWGV
FT                   SLYFLMAMFLCSCAIIAACYWWMNRYVLTDPRFYNPAELKAKKSKPKMSMGESFSYLLR
FT                   SPYMLLLALLVICYGICINLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVML
FT                   FIGGNVIRRFGWLTGALVTPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVG
FT                   AIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLV
FT                   VCGSIGAMTPFLAVALFAIIMVWLTSATKLNKLFLAASAAKEQELAEAAAAEKEASSAA
FT                   KESAPAIEGVS"
     atgactcaaa ccgcggaaaa accttttgga aaattgcgct ctttcctttg gccgatacac        60
     atgcatgagc tgaagaaagt tctgccaatg ttcctaatgt tcttctgtat ttcattcaat       120
     tacacgattt tgagagatac aaaagatact cttatcgtta cagcaccggg atctggagca       180
     gaggccattc ctttcattaa gttgtggcta gtcgtccctt ctgctgttgt gttcatgctt       240
     atctacgcca agctaagcaa tattttgaac aaacaggctc ttttcttcgc agtgctctca       300
     ccattcgttg tattcttcgc actgttccct gtggtgatct acccttgccg tcatattctt       360
     cacccaacag ctttcgctga tactctacaa tccattcttc cttccggatt tatgggattc       420
     attgcgatgc tacgcaactg gacatttgct gtgttctacg tactttctga actttgggga       480
     agcgttatgc tctctttgat gttctggggc tttgccaatg aaattactaa aattagcgaa       540
     gctaaacgtt tctacgctct tttcggagta ggagctaacg tagctctctt aatttctggt       600
     ccagctatta tctggtcttc taaattacgc gctagccttg gcgaaggcgt tgacccatgg       660
     ggagtcagcc tctatttcct aatggctatg ttcttgtgtt cttgcgctat tattgctgct       720
     tgctactggt ggatgaaccg ctacgtgctt acagatccta gattctacaa tcctgcagag       780
     ctcaaagcta agaaatctaa acctaagatg agcatgggcg aaagcttctc ttatctgtta       840
     agatctcctt atatgcttct tctagctctt ctagttattt gctacggaat ctgcattaac       900
     ctcgttgaag taacttggaa aagccaactc aaaatgcaat tccctaatcc aaatgactac       960
     agcgcattta tggggaactt ctctttctgg acaggagttg tatctgtatt tgtaatgctc      1020
     ttcatcggtg gtaacgttat ccgtagattc ggttggttaa ctggagcttt ggttacacct      1080
     atcatggttc tcgtaacagg agctgtcttc tttgctctcg ttatcttcag agatcatgct      1140
     acaggtttag ttgctgcttt gggaacaaca ccactaatgc tagccgttgt tgtcggagcc      1200
     attcaaaata ttctttccaa atcaactaaa tatgctctct ttgatgcaac taaagagatg      1260
     gcttacatcc cattggacca agagcaaaaa gttaaaggga aagctgctat tgacgttgtt      1320
     gccgctagat tcggtaaatc tgggggatct ttgatccaac aaggtctctt ggtcgtttgc      1380
     ggaagcatcg gcgctatgac tccattccta gctgttgctc tctttgcaat tatcatggtc      1440
     tggttgacat ctgcaactaa actaaacaaa ctgttcttgg ctgcatccgc tgctaaagaa      1500
     caggaattag cagaagctgc agcagcagag aaggaagctt cttctgcggc taaagaatcc      1560
     gctcctgcta tagaaggtgt ttcttaa                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page