(data stored in SCRATCH zone)

EMBL: CP001887.PE684

CP001887.PE684       Location/Qualifiers
FT   CDS_pept        753818..754825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03470"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18372"
FT                   /protein_id="ADH18372.1"
FT                   /translation="MILEIPAPTAVFSFVIDEQLTGRLDKGLVSYNGAYSRAFYQQQIE
FT                   LGRVRVNGRVYTRVSHPLSLGDVVEVELIEEEEPSSLIPEDIPLDKVYEDDMILVINKP
FT                   RDMVVHPAPGHTQGTVVHALLHEIGERLKQEFPEEPWRPGIVHRLDKDTSGLLITVKTR
FT                   RAKALYSELFATKQVKKLYVAICINAPSQELIHTRIARHPLKRKEMTVLSTHAEGGKEA
FT                   ITHCHVLATNGRLSVVALYPETGRTHQLRVHMKHLGTPILGDPVYGIPSINFRYGLDKQ
FT                   QLHAYSLVFAHPESAERVKLVTKLPDDMTSLIEKEFREGVSILDGSCDWFKITR"
     ttgattctgg aaatccctgc tccaacggct gttttttcat ttgtaattga tgaacaatta        60
     acaggacgcc ttgataaggg gctggtctca tataatggag cgtattcacg agctttttat       120
     cagcaacaaa ttgagttagg gcgtgtccgt gttaatgggc gggtgtatac gcgtgtttcc       180
     catccgttat ccctagggga tgtggtagaa gtggaattga tagaagagga agaaccctct       240
     tctttaatcc cggaagatat tcccctggat aaggtatatg aagacgatat gattttggtc       300
     attaataaac caagagatat ggttgtccat cctgctcccg ggcatacgca aggtacggtg       360
     gtgcatgctt tgctgcatga aatcggggag cgtctgaaac aagagttccc cgaggagcca       420
     tggcgcccag ggattgtaca tcgcttagat aaagatactt ctggtttgtt gattacagta       480
     aaaactcggc gagctaaggc tctctatagt gagctctttg ctaccaaaca ggtaaaaaag       540
     ctttacgtag ccatttgcat taatgctccg tctcaggaac ttattcatac tcggatagcg       600
     cgtcatcctc taaaacggaa agaaatgact gtgctttcta cacatgctga aggcggtaag       660
     gaagccatta cccattgtca tgttctagct acgaatggac gattaagtgt ggttgctcta       720
     tacccagaaa caggcagaac ccaccagctt cgtgtacata tgaagcacct gggcacaccg       780
     attctcggag atcccgttta cgggatcccc tctataaatt ttcgttatgg tcttgacaaa       840
     caacaattgc atgcctatag cttggttttt gctcatccgg agagtgcgga gcgagtgaag       900
     ctagtgacaa agcttccaga cgatatgact tccttaatag aaaaggaatt tagagaaggt       960
     gtctctatac tggatggttc gtgtgattgg tttaaaatca ctaggtag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page