(data stored in SCRATCH zone)

EMBL: CP001887.PE694

CP001887.PE694       Location/Qualifiers
FT   CDS_pept        764196..764645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03520"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18382"
FT                   /protein_id="ADH18382.1"
FT                   /translation="MADLDVFKEDFALLFEAGMVAIKQGDEASAKALFQALQVLDPEHT
FT                   AHELGSGLLHLHKMELTKAEVLFRAIVEKDPENWSAKAFLSLTLMMIVLQQGSSFEVRR
FT                   ESLERCLQLADQVLESCEVESTRALAKSVLDWHDGLVAKSGGPLN"
     atggcagatt tggatgtatt taaagaagat tttgcattgt tgtttgaagc aggaatggtt        60
     gctatcaaac aaggggatga agcaagcgct aaagcgttat ttcaagcatt acaagtattg       120
     gatcctgagc atacagcaca tgagttagga tcaggattgt tgcatttgca taaaatggag       180
     ctcacaaaag cagaagtttt attccgtgct attgttgaaa aagatcccga gaattggagt       240
     gctaaggcat ttttatcact cacacttatg atgatcgttc ttcagcaagg aagttctttc       300
     gaagtgcgta gagagagttt ggagcgctgc ttacagttag ctgatcaggt attagaaagt       360
     tgtgaagtag agtctacaag agctttagct aagtctgttc tggattggca tgatggatta       420
     gttgctaaaa gtggtgggcc tttaaattag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page