(data stored in SCRATCH zone)

EMBL: CP001887.PE695

CP001887.PE695       Location/Qualifiers
FT   CDS_pept        764665..765336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18383"
FT                   /protein_id="ADH18383.1"
FT                   /translation="MIDPLKLFPNFDGDKESAAVNKPSASPMPSELSKNVASFSLGGGG
FT                   AALDSTVSTEKLSLMAMMQDKNSQLIDPELEEALNSEELQEQIHLLKSRLWDAQTQMQM
FT                   QDPDKLASEHVDALGVIVDLINGDFQAIAEHTQQTVKQGNGDEEKSVTRKIVDWVSSGE
FT                   EILNRALLYFSDRNGERETLADFLKVQYAVQRATQRAELFASILGATVSSVKTIMTTQL
FT                   G"
     atgatagatc ctcttaagct ttttccaaat tttgatgggg ataaggagag tgctgcggtg        60
     aataaacctt cagcatctcc tatgcccagc gaattaagta aaaatgttgc ctcattctct       120
     ttagggggtg gaggtgctgc gttggattcg acagtgtcca cagaaaagct atcgttgatg       180
     gctatgatgc aggataaaaa ttcgcagttg atcgatcctg agttggagga agctctgaac       240
     tctgaagagt tacaagagca gatccatttg ttaaaaagtc gtttgtggga tgcacaaacg       300
     cagatgcaaa tgcaagatcc tgacaagttg gcctctgagc atgtagatgc tttaggagtc       360
     attgttgatt taatcaatgg ggattttcaa gcgatagctg aacatacaca acagacggtc       420
     aagcagggta atggtgacga agaaaaatct gttacacgca agatagtcga ttgggtctct       480
     tcaggagaag aaattttgaa tcgtgctttg ttgtatttct ccgatcgtaa tggagaaaga       540
     gaaacattag ccgatttctt aaaagttcag tatgccgttc aaagagctac acaacgcgcc       600
     gagttatttg ccagtattct aggtgctacg gtgagtagtg taaaaacgat tatgacaacc       660
     cagttaggtt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page