(data stored in SCRATCH zone)

EMBL: CP001887.PE702

CP001887.PE702       Location/Qualifiers
FT   CDS_pept        complement(773863..774933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03560"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="COG3869 Arginine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18390"
FT                   /protein_id="ADH18390.1"
FT                   /translation="MLPNHILTAIATIKHSLRTETPRPICTLSLSRNLSVSKFVPCLSK
FT                   ENKRDVLETIAKQFSAIEGEEFFVLPLKDLPIWQRECLLEHYLFPYHLGSYLEGEALIV
FT                   NQAGTLLAGINLRDHLVIHGVDFVWQPEVLLQKLIDLDIRLQQSLSFAFSSDFGFLTAD
FT                   PLRCGTALIARAFVHVPALKYGDALSELLVPYQREFASSSLLPLSQESLGDILCLSNIC
FT                   SLGLSEEQILSSLRLVVSKILSAEREARNQLVKENPTEIKNRILRSVGMLTHSCCLDLQ
FT                   EALDATSWIQLGMSMQWIEDSEKHPLWNPLFWDLRRGHLALYNQDTANRSIEKEVIAQI
FT                   RAKATKPQAERLIIRI"
     atgctcccta atcatattct tactgctatc gcaacgatca aacattcttt gagaacggag        60
     acgccgcgcc ctatttgcac gctctcttta tctagaaatc tttctgtttc caaattcgtt       120
     ccctgtcttt ctaaggaaaa caaacgtgat gtgttagaga ctatagccaa acagttttca       180
     gctatcgaag gtgaggaatt ctttgtttta cccctgaaag atttgcctat ctggcaacga       240
     gaatgtttat tagaacatta tttgtttcca tatcatcttg ggagttattt ggaaggtgag       300
     gctctgattg taaatcaggc aggcacgttg ttagccggca ttaatctacg tgaccactta       360
     gtgatccatg gcgtagattt tgtatggcag ccggaagtat tactccagaa gctgatcgat       420
     ttagatatac gtttacaaca gtctctttct tttgcttttt cttcggattt tggattttta       480
     accgcagatc ccctacgttg tggaacggcg ctgatagcgc gagcctttgt tcatgttccg       540
     gctcttaagt atggagacgc gttgtctgag cttttagttc cttatcaacg cgagttcgct       600
     agctcttctt tacttccgtt atcacaggaa tcattaggag atatcttgtg cttgtccaat       660
     atttgttcat tagggctatc agaagagcag atcctatctt cattaagact agtagtgtca       720
     aaaattttat ctgctgagag agaggctaga aaccagcttg tgaaagaaaa tcctacagaa       780
     ataaaaaatc gcattttacg ttctgtgggg atgttgacac attcttgttg tttagatttg       840
     caagaggcat tggatgccac tagctggata caattaggaa tgagtatgca gtggattgaa       900
     gatagcgaaa aacacccttt atggaatcct ttattctggg atctacgcag aggtcacctt       960
     gctctgtata accaagatac tgcgaataga agcattgaaa aggaagtgat cgcccagatc      1020
     cgggccaagg caacaaaacc ccaggcagag cgactgatta ttcgaatctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page