(data stored in SCRATCH zone)

EMBL: CP001887.PE709

CP001887.PE709       Location/Qualifiers
FT   CDS_pept        778987..779115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18397"
FT                   /protein_id="ADH18397.1"
FT                   /translation="MQSSFREILDLVGKGIGRRSSRAQKILQKKTGPDRNRAQKHG"
     atgcaatctt cttttagaga aattttagat ttggttggga aagggatagg aaggagatca        60
     agtagagcac aaaagatttt gcaaaaaaaa actggacccg accgaaatcg agcccagaaa       120
     cacggatag                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page