(data stored in SCRATCH zone)

EMBL: CP001887.PE711

CP001887.PE711       Location/Qualifiers
FT   CDS_pept        780962..784204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_03610"
FT                   /product="penicillin-binding protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18399"
FT                   /protein_id="ADH18399.1"
FT                   /translation="MKRKRRTPLSVPEKANRLLVGFIIALSIITLRIWHVAVVQHEKKK
FT                   EEAYRPQRRSVPEHCDRAGVCDRFGKTLAENVLQYNVGISYRAIRDIPTRVWHTDEQGN
FT                   KRLVPVRKDYIKKFADFLAQELHMDRDFVEDTIHAKASVLGSVPYILQANVSERTFLRL
FT                   KMLEKDWPGLHVESSVRRHYPEGRTVADLLGYVGPISAEEHRKITRELGNLRECIRSYE
FT                   EGEDPKFPVGISSVDQVRKLLHELEMHAYGLNSLIGKLGVEAFCDRKLRGLIGKRSMLV
FT                   DRRGNFIQEMEGSSVGSPGRKIQLTISTELQAFAHELLAEHERGEVFCDYRQWRQQQYL
FT                   PPFFPWIKGGAIVAMDPKNGQILAMASSPRYDNNDFINMKDSPNQEECRSSVLRWLENL
FT                   EYIGEVFDRRVPLRRERLDPLSGKYFDEELSFSYRAFLDFILPDTSKVKQMLCEKGSVG
FT                   LSIYLQGTIEQLLEMFECEEKECGLVFDVLFPKEDGHEIIGEVTSLKRQKQFKAILAER
FT                   EEEVQAFRERLGSIFADLSANYDKILFLDLLRTAVDPEKVSISLLAEIGHMSVLDFVDY
FT                   QGHFIALRKSFAKLMENAFIDHDFTAWREEHFTQFIKQKRDEELERKQQYPTPYVDYLV
FT                   EERSRQYALFCREHMDSFITFLLSEIEPPLGNPYYQEIACWRQELRSGAYPALEWREHY
FT                   DFLHKHLSQTSYDLCELFAAFREFSELKRPLYGQYPLTLTRNIEQIEQDLIASFYPLYG
FT                   YGHLSAHAFGQAATLGSIFKLVSAYSVLVQHLSDQEDLSKLLVIVDKQSLGLRSGKPHV
FT                   GFFKDGSPIASFFKGGILPGNDYSGRGYIDLIAALEMSSNPYFSLLVSEYLSDPEDLCE
FT                   AAKLFGFGEKTGIGLPGEYAGRVPIDVAYNRSGLYATAIGQHTLVVTPLQTAVMMATLV
FT                   NGGIVYQPSLIQGEWYQGSFSPEQAKKKREIFLPDSIVDLFKRGMHNVIWGQYGTTRFM
FT                   RQRFAPERLARIIGKTSTAEVIARVGLDRERGRMKLKDVWFAAVGYEDEALSHPDIVVV
FT                   VYLRLGEFGRDAAPMAVRIIEKWEEIRKKSFS"
     atgaaaagaa aacgacgcac cccactttct gtgccagaaa aggctaacag actacttgtg        60
     ggatttatta ttgctttgtc tatcatcact ttgcgtatat ggcatgttgc tgttgtgcag       120
     catgagaaaa agaaggaaga agcttaccgt cctcagcgta gaagtgttcc tgagcattgt       180
     gatcgcgcag gagtatgtga tcgttttggt aaaacgctgg cagaaaacgt tttacaatat       240
     aatgtgggga tctcttatcg agcgatacgt gatattccga cgcgtgtttg gcatacagat       300
     gagcaaggga ataagaggct tgttcctgtt cgtaaggatt acattaaaaa atttgcagat       360
     tttttggctc aagagctgca tatggaccgg gatttcgttg aagatacgat ccatgccaaa       420
     gcttctgtat tagggtctgt accttacatc cttcaggcta atgtatctga gcgtactttt       480
     ttaaggctca agatgctgga gaaggattgg ccaggattgc atgtcgaatc ttcggttcgc       540
     agacattatc ctgaagggcg cacagtagct gatttgttgg ggtatgtcgg acctattagc       600
     gcagaagaac atagaaaaat tacgagggag ttaggaaatc tcagagaatg cattcgttct       660
     tatgaagagg gtgaggatcc taaatttcct gtaggaatat cgagcgtcga tcaagtacgc       720
     aagcttttgc atgagttaga gatgcatgcc tatggattaa actccttgat cggcaaatta       780
     ggtgtagaag ctttttgtga tcgtaaatta agaggtttga taggcaagcg atctatgctg       840
     gtagatcgaa gagggaattt tattcaggag atggaaggtt cttctgttgg aagcccaggt       900
     agaaaaatcc agttaacgat ctctacagag ctacaagctt ttgctcatga gctccttgca       960
     gaacatgagc gaggtgaggt gttttgcgat tatcgacagt ggcgtcagca acaatatttg      1020
     ccgccttttt tcccttggat aaaaggcggg gcgattgttg ctatggatcc taagaatggg      1080
     caaattctag cgatggcctc ttcaccacgt tatgacaata atgactttat caatatgaaa      1140
     gactctccta atcaggagga gtgtcgttct tctgtattgc gatggctgga aaaccttgag      1200
     tacatcggag aagtatttga tagacgcgtt cctttacgaa gagagcgatt ggatcctctc      1260
     agtggaaaat attttgatga agagctctct ttttcgtatc gagctttttt agattttatt      1320
     ttgccagaca cttctaaagt taagcagatg ctatgtgaga aagggtctgt tgggctttct      1380
     atttatctgc aaggaacgat cgagcagctt ttggaaatgt ttgagtgtga agaaaaagag      1440
     tgtggtctcg tttttgatgt tctattccct aaagaggatg ggcatgagat tatcggagag      1500
     gtcacatctc ttaaacgaca gaaacagttt aaagctatcc ttgctgaaag agaagaagag      1560
     gtacaagctt ttcgcgagcg tcttggctct atttttgcag atctatctgc caactacgat      1620
     aaaattctat ttctggatct attgcgtacg gcagtagatc cagaaaaagt ctctatctct      1680
     ttattagcag aaattggtca tatgtctgtc ttggattttg tagattatca agggcatttc      1740
     attgctttgc ggaaatcatt tgctaaactg atggagaatg catttatcga tcatgatttt      1800
     accgcttggc gtgaagagca tttcacacag tttattaagc agaaacgcga tgaggagttg      1860
     gagaggaaac aacaataccc aaccccttat gtggattatt tagtagaaga gcggtctcgg      1920
     caatatgctc ttttttgccg agagcatatg gattctttta ttactttttt actgtcagag      1980
     atagagcctc ctcttggtaa tccctattat caggagattg cttgttggcg ccaagaacta      2040
     cgttctggcg cttaccctgc tttagaatgg cgagagcatt acgatttttt acataagcat      2100
     ttgtcgcaga cctcttatga tttatgcgaa ctgtttgcag cttttcgaga gttttctgag      2160
     cttaagcgtc ctctatatgg acaatatcca ctaacactga cgcggaacat agagcaaata      2220
     gagcaggatc tgatcgcttc tttttaccca ttgtatggtt atgggcatct atctgctcat      2280
     gctttcggtc aagcagcgac tttagggtct atttttaagt tagtatctgc ttattccgtt      2340
     cttgtgcagc atctttctga ccaagaagat ttatctaagt tattggtgat cgtagataag      2400
     caatctctgg ggctgcgttc tgggaagcct catgttggat tttttaaaga cggctctcct      2460
     attgcttctt tctttaaagg agggattctg cctgggaatg attattctgg gagaggatat      2520
     atcgatctga tcgcagcttt ggagatgtct agcaatccct atttttctct tctcgttagt      2580
     gaatatcttt ctgatcctga agatttatgc gaggcagcta aactcttcgg ttttggagaa      2640
     aaaacaggga taggacttcc tggagaatat gctggaagag tgcctatcga tgtcgcatat      2700
     aaccgttcgg ggttatatgc gactgctatt gggcaacata cattagtggt gactccttta      2760
     caaaccgcag tgatgatggc gacgttagtt aatggaggga ttgtctatca gccgagtttg      2820
     atacaaggtg agtggtatca aggaagtttt tctccagaac aagctaagaa gaaaagagaa      2880
     attttcttgc cagattcgat cgtcgatcta tttaagagag gtatgcataa cgtgatttgg      2940
     ggtcaatacg ggacgacgcg gttcatgcgt caacggtttg ctcctgaacg attggctcgt      3000
     attattggca aaacgagcac agcagaagtg attgcgcgag tagggttaga tcgtgagcga      3060
     ggacgcatga aattgaaaga cgtgtggttc gctgcggtag gatatgaaga tgaagcgtta      3120
     tctcatccgg atattgttgt tgttgtgtac ttacggctag gagagtttgg aagggatgct      3180
     gcgcctatgg cagtgcgtat aatagagaaa tgggaagaga ttcgtaaaaa atctttcagc      3240
     taa                                                                    3243
//

If you have problems or comments...

PBIL Back to PBIL home page